Clone BO24555 Report

Search the DGRC for BO24555

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:245
Well:55
Vector:pDNR-Dual
Associated Gene/TranscriptCG34298-RA
Protein status:BO24555.pep: Imported from assembly
Sequenced Size:451

Clone Sequence Records

BO24555.complete Sequence

451 bp assembled on 2010-05-18

GenBank Submission: KX796449

> BO24555.complete
GAAGTTATCAGTCGACATGCAGAATCCCATTTGTGAACCGTTCACCAGTT
GGCCGGTAAAGTTCGACATCAACCAGCTCATCAAGGAGTTCCAGCCCGAG
GAGAAGGGGCGCCAGGTAGATGAGGATAAGTCGCCGCGGGACTTTCTCCA
CCTACCCGACAACAACTGGGTGGTCCTGCCCAGTTTTAAGTACCAATTCG
AGCACTTGACCCCGTATCTTTCCTGCCGCCAGAGCAAATATATGCGGTGC
CGCTTTCAGAAGTTTTTAGATAATGTTCCCAGCAGCTATGTGACCATCTC
CTTGTATGGCTCCAATGTGAGCAACATGCCTAAGCCGAGGCGAAAGAGTC
TGAATGGCCAGTTCTACGGGGTGGATAACAAACTGGCTCCTGTTCCGGCG
GTCGCAGATCCTCGCTCTCCTCCGCACCGAAAGGCAAGCTTTCTAGACCA
T

BO24555.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:46:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG34298-RA 420 CG34298-PA 1..417 17..433 2070 99.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:46:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG34298-RA 548 CG34298-RA 48..464 17..433 2070 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:46:13
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29999842..30000149 17..324 1540 100 Plus
3R 32079331 3R 30000211..30000319 325..433 530 99.1 Plus
Blast to na_te.dros performed on 2014-11-28 02:46:14 has no hits.

BO24555.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-18 11:29:10 Download gff for BO24555.complete
Subject Subject Range Query Range Percent Splice Strand
CG34298-RA 1..417 17..435 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:27:00 Download gff for BO24555.complete
Subject Subject Range Query Range Percent Splice Strand
CG34298-RA 48..464 17..435 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:35:39 Download gff for BO24555.complete
Subject Subject Range Query Range Percent Splice Strand
CG34298-RA 48..464 17..435 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:35:39 Download gff for BO24555.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29999842..30000149 17..324 100 -> Plus
3R 30000211..30000319 325..435 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:27:00 Download gff for BO24555.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25825564..25825871 17..324 100 -> Plus
arm_3R 25825933..25826041 325..435 97   Plus

BO24555.pep Sequence

Translation from 16 to 451

> BO24555.pep
MQNPICEPFTSWPVKFDINQLIKEFQPEEKGRQVDEDKSPRDFLHLPDNN
WVVLPSFKYQFEHLTPYLSCRQSKYMRCRFQKFLDNVPSSYVTISLYGSN
VSNMPKPRRKSLNGQFYGVDNKLAPVPAVADPRSPPHRKASFLDH

BO24555.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:56:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG34298-PA 139 CG34298-PA 1..139 1..139 763 100 Plus