Clone BO24567 Report

Search the DGRC for BO24567

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:245
Well:67
Vector:pDNR-Dual
Associated Gene/TranscriptCG34309-RA
Protein status:BO24567.pep: Imported from assembly
Sequenced Size:337

Clone Sequence Records

BO24567.complete Sequence

337 bp assembled on 2010-05-18

GenBank Submission: KX795419

> BO24567.complete
GAAGTTATCAGTCGACATGAAACACCAACAAGTTACGGTGGACTATTGGA
CCATGTTTAAGACATCGGGATTGTGTCTTTTACTGGCCATTTGCGGATTT
GTACTTCTTAAAATGGTGCAGACCATTTTCTGGCTACCTGGACATCTGAA
GAAGAACCAGCAGCGCCTGGAGGATCTGGCCAAAATCTATGCCAAGGATA
TTAGCGAGGAAGAGAGGGACGAGATCGAGAAACTGTTCAACAGTAAGGAG
CCGCTGACTGAAGAACGAATCAACCAGTTGCTCGACAAGCCAGAGACTTC
AGAGCCAAAAAAGGAGCAAGCAAGCTTTCTAGACCAT

BO24567.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:47:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG34309-RA 306 CG34309-PA 1..303 17..319 1515 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:47:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG34309-RA 588 CG34309-RA 35..337 17..319 1515 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:47:19
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13372868..13373075 112..319 1040 100 Plus
3R 32079331 3R 13372664..13372758 17..111 475 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:47:19 has no hits.

BO24567.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-18 11:29:32 Download gff for BO24567.complete
Subject Subject Range Query Range Percent Splice Strand
CG34309-RA 35..337 17..321 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:27:22 Download gff for BO24567.complete
Subject Subject Range Query Range Percent Splice Strand
CG34309-RA 35..337 17..321 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:36:01 Download gff for BO24567.complete
Subject Subject Range Query Range Percent Splice Strand
CG34309-RA 35..337 17..321 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:36:01 Download gff for BO24567.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13372664..13372758 17..111 100 -> Plus
3R 13372868..13373075 112..321 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:27:22 Download gff for BO24567.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9198386..9198480 17..111 100 -> Plus
arm_3R 9198590..9198797 112..321 99   Plus

BO24567.pep Sequence

Translation from 16 to 337

> BO24567.pep
MKHQQVTVDYWTMFKTSGLCLLLAICGFVLLKMVQTIFWLPGHLKKNQQR
LEDLAKIYAKDISEEERDEIEKLFNSKEPLTEERINQLLDKPETSEPKKE
QASFLDH

BO24567.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:58:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG34309-PA 101 CG34309-PA 1..101 1..101 527 100 Plus