Clone BO24568 Report

Search the DGRC for BO24568

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:245
Well:68
Vector:pDNR-Dual
Associated Gene/TranscriptCG42246-RA
Protein status:BO24568.pep: Imported from assembly
Sequenced Size:301

Clone Sequence Records

BO24568.complete Sequence

301 bp assembled on 2010-05-18

GenBank Submission: KX796275

> BO24568.complete
GAAGTTATCAGTCGACATGGCTTTTCTTTTTAAACTATTTACCTTCTTGG
CGGTGGCCGCCATTTTGATCCAAATGACACTTGCACTGGAGTTTATGGAT
GAAGACTTTCTGGCAAACGATGACGGTCATCACTTGGACGAAGAGTCCGC
TGAAGTGCCTGGTATTTTGACTGGTTATACCAGAGATACGATCGCTCACT
TTAATCCTCGCAAAGTAGATGGGGGATTTCGACAATTGTGGGAACGTGTT
CCCCTTCAAAAAGTCGATGATATTAAGCGGAGAGCAAGCTTTCTAGACCA
T

BO24568.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:47:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG42246-RB 270 CG42246-PB 1..267 17..283 1335 100 Plus
CG42246-RA 270 CG42246-PA 1..267 17..283 1335 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:47:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG42246-RB 387 CG42246-RB 70..337 16..283 1340 100 Plus
CG42246-RA 578 CG42246-RA 70..337 16..283 1340 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:47:23
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7411508..7411715 283..76 1040 100 Minus
X 23542271 X 7411777..7411837 76..16 305 100 Minus
Blast to na_te.dros performed 2014-11-28 02:47:25
Subject Length Description Subject Range Query Range Score Percent Strand
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 3915..3979 121..59 121 69.2 Minus

BO24568.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-18 11:29:33 Download gff for BO24568.complete
Subject Subject Range Query Range Percent Splice Strand
CG42246-RA 86..337 32..285 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:27:24 Download gff for BO24568.complete
Subject Subject Range Query Range Percent Splice Strand
CG42246-RA 86..337 32..285 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:36:03 Download gff for BO24568.complete
Subject Subject Range Query Range Percent Splice Strand
CG42246-RA 86..337 32..285 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:36:03 Download gff for BO24568.complete
Subject Subject Range Query Range Percent Splice Strand
X 7411506..7411714 77..285 99 <- Minus
X 7411777..7411821 32..76 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:27:24 Download gff for BO24568.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 7305539..7305747 77..285 99 <- Minus
arm_X 7305810..7305854 32..76 100   Minus

BO24568.pep Sequence

Translation from 16 to 301

> BO24568.pep
MAFLFKLFTFLAVAAILIQMTLALEFMDEDFLANDDGHHLDEESAEVPGI
LTGYTRDTIAHFNPRKVDGGFRQLWERVPLQKVDDIKRRASFLDH

BO24568.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:58:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG42246-PB 89 CG42246-PB 1..89 1..89 462 100 Plus
CG42246-PA 89 CG42246-PA 1..89 1..89 462 100 Plus