Clone BO24569 Report

Search the DGRC for BO24569

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:245
Well:69
Vector:pDNR-Dual
Associated Gene/TranscriptCG34160-RA
Protein status:BO24569.pep: Imported from assembly
Sequenced Size:247

Clone Sequence Records

BO24569.complete Sequence

247 bp assembled on 2010-05-24

GenBank Submission: KX795893

> BO24569.complete
GAAGTTATCAGTCGACATGTCCAACAACAAGGCATCCTCTTCCCGAGGCC
GACATCCTGGGATGCAGTTCAGCACTGCCATGGGAACGCCGGAAACCAAG
CGCAAGATGCTTCTCTATAGACGATTATTGTGCCGTGAGTTGGCACGTGA
CGGGAAAACTCCCCGGGAGATCGCAAGGGCTAGAAATCTAACGCTTCAAG
AGCAGGATCAGGGCAGGTTTCCGAAGTCCGCAAGCTTTCTAGACCAT

BO24569.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:50:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG34160-RA 216 CG34160-PA 1..213 17..229 1065 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:50:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG34160-RA 497 CG34160-RA 153..365 17..229 1065 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:50:25
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10579997..10580192 34..229 980 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:50:26 has no hits.

BO24569.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-24 09:46:57 Download gff for BO24569.complete
Subject Subject Range Query Range Percent Splice Strand
CG34160-RA 97..309 17..231 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:28:34 Download gff for BO24569.complete
Subject Subject Range Query Range Percent Splice Strand
CG34160-RA 153..365 17..231 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:37:07 Download gff for BO24569.complete
Subject Subject Range Query Range Percent Splice Strand
CG34160-RA 153..365 17..231 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:37:07 Download gff for BO24569.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10579905..10579921 17..33 100 -> Plus
2L 10579997..10580192 34..231 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:28:34 Download gff for BO24569.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10579905..10579921 17..33 100 -> Plus
arm_2L 10579997..10580192 34..231 98   Plus

BO24569.pep Sequence

Translation from 16 to 247

> BO24569.pep
MSNNKASSSRGRHPGMQFSTAMGTPETKRKMLLYRRLLCRELARDGKTPR
EIARARNLTLQEQDQGRFPKSASFLDH

BO24569.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 04:58:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG34160-PA 71 CG34160-PA 1..71 1..71 365 100 Plus