BO24569.complete Sequence
247 bp assembled on 2010-05-24
GenBank Submission: KX795893
> BO24569.complete
GAAGTTATCAGTCGACATGTCCAACAACAAGGCATCCTCTTCCCGAGGCC
GACATCCTGGGATGCAGTTCAGCACTGCCATGGGAACGCCGGAAACCAAG
CGCAAGATGCTTCTCTATAGACGATTATTGTGCCGTGAGTTGGCACGTGA
CGGGAAAACTCCCCGGGAGATCGCAAGGGCTAGAAATCTAACGCTTCAAG
AGCAGGATCAGGGCAGGTTTCCGAAGTCCGCAAGCTTTCTAGACCAT
BO24569.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:50:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34160-RA | 216 | CG34160-PA | 1..213 | 17..229 | 1065 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:50:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34160-RA | 497 | CG34160-RA | 153..365 | 17..229 | 1065 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:50:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 10579997..10580192 | 34..229 | 980 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 02:50:26 has no hits.
BO24569.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-24 09:46:57 Download gff for
BO24569.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34160-RA | 97..309 | 17..231 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:28:34 Download gff for
BO24569.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34160-RA | 153..365 | 17..231 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:37:07 Download gff for
BO24569.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34160-RA | 153..365 | 17..231 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:37:07 Download gff for
BO24569.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 10579905..10579921 | 17..33 | 100 | -> | Plus |
2L | 10579997..10580192 | 34..231 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:28:34 Download gff for
BO24569.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 10579905..10579921 | 17..33 | 100 | -> | Plus |
arm_2L | 10579997..10580192 | 34..231 | 98 | | Plus |
BO24569.pep Sequence
Translation from 16 to 247
> BO24569.pep
MSNNKASSSRGRHPGMQFSTAMGTPETKRKMLLYRRLLCRELARDGKTPR
EIARARNLTLQEQDQGRFPKSASFLDH
BO24569.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 04:58:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34160-PA | 71 | CG34160-PA | 1..71 | 1..71 | 365 | 100 | Plus |