Clone BO24581 Report

Search the DGRC for BO24581

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:245
Well:81
Vector:pDNR-Dual
Associated Gene/Transcript
Protein status:BO24581.pep: Imported from assembly
Sequenced Size:406

Clone Sequence Records

BO24581.complete Sequence

406 bp assembled on 2010-05-18

> BO24581.complete
GAAGTTATCAGTCGACATGAGACGATGCAAGACAATTCAAATGCTGTTCC
TCTGTTTGATGATGAGAATGCGAGAAAGTCATGAGCGGCCCACGCCGAAA
AATCTGCTGGAACAAATGCTGCCTGCTGACACCTTTGACGTTATCCGGAG
AATACCTCGCTCCGATGAACCCGGTCCGGATGCCAAAGGGGACCTGAAGC
TGTTGCATGCTCCCTGCGAGTTTGACTTGATAAGATACACATCGATTAAC
CACTATCCCATTTATTGCCTGCCCGTCTACACAAATCGGCACGTGAACGA
GGACTGGTATCGACTTTATAGGACCTACGACACCGAGGGATTTGTTTTCG
GGCAGTTTTACGAGCGTCTCCAGCGGTACGAGTTGGACGCAAGCTTTCTA
GACCAT

BO24581.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:47:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG34234-RA 351 CG34234-PA 1..348 41..388 1740 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:47:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG34234-RA 603 CG34234-RA 11..383 16..388 1865 100 Plus
Dh44-R2-RB 3069 CG12370-RB 2022..2349 388..61 1640 100 Minus
Dh44-R2-RB 3069 CG12370-RB 2406..2451 61..16 230 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:47:46
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12486939..12487266 388..61 1640 100 Minus
2R 25286936 2R 12487323..12487368 61..16 230 100 Minus
Blast to na_te.dros performed on 2014-11-28 02:47:47 has no hits.

BO24581.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-18 11:29:38 Download gff for BO24581.complete
Subject Subject Range Query Range Percent Splice Strand
CG34234-RA 1..348 41..390 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:27:32 Download gff for BO24581.complete
Subject Subject Range Query Range Percent Splice Strand
CG34234-RA 12..383 17..390 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:36:11 Download gff for BO24581.complete
Subject Subject Range Query Range Percent Splice Strand
CG34234-RA 12..383 17..390 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:36:11 Download gff for BO24581.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12486936..12487265 62..390 99 <- Minus
2R 12487323..12487367 17..61 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:27:32 Download gff for BO24581.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8374441..8374770 62..390 99 <- Minus
arm_2R 8374828..8374872 17..61 100   Minus

BO24581.pep Sequence

Translation from 16 to 406

> BO24581.pep
MRRCKTIQMLFLCLMMRMRESHERPTPKNLLEQMLPADTFDVIRRIPRSD
EPGPDAKGDLKLLHAPCEFDLIRYTSINHYPIYCLPVYTNRHVNEDWYRL
YRTYDTEGFVFGQFYERLQRYELDASFLDH

BO24581.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:59:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG34234-PA 116 CG34234-PA 1..116 9..124 640 100 Plus
CG30270-PD 78 CG30270-PD 4..76 59..130 177 43.8 Plus
CG30270-PC 78 CG30270-PC 4..76 59..130 177 43.8 Plus