BO24584.complete Sequence
205 bp assembled on 2010-05-24
GenBank Submission: KX796822
> BO24584.complete
GAAGTTATCAGTCGACATGTCGGAAACTAGCTCCAAGGATAATGTCAAAA
CGGCAATGACCTATATTTGTGGAGAATGCCATCATGAAAACGAAATGCGC
CCCAGGGATCCGATTCGTTGTCGCGAGTGTGGATATCGTATCATGTACAA
AAAGCGCACCAAGCGTCTTGTTGTCTTTGATGCCCGTGCAAGCTTTCTAG
ACCAT
BO24584.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:50:23
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Rpb12-RA | 174 | CG34186-PA | 1..171 | 17..187 | 855 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:50:24
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Rpb12-RA | 353 | CG34186-RA | 80..250 | 17..187 | 855 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:50:21
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2R | 25286936 | 2R | 15145179..15145273 | 167..73 | 475 | 100 | Minus |
| 2R | 25286936 | 2R | 15145383..15145440 | 74..17 | 290 | 100 | Minus |
Blast to na_te.dros performed 2014-11-28 02:50:22
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 297 | 6995 | 297 DMIS297 6995bp Derived from X03431 (g8146) (Rel. 36, Last updated, Version 2). | 2945..2982 | 90..53 | 100 | 73.7 | Minus |
BO24584.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-24 09:46:56 Download gff for
BO24584.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG34186-RA | 59..229 | 17..189 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:28:33 Download gff for
BO24584.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Rpb12-RA | 80..250 | 17..189 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:37:05 Download gff for
BO24584.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Rpb12-RA | 80..250 | 17..189 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:37:05 Download gff for
BO24584.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 15145179..15145271 | 75..167 | 100 | <- | Minus |
| 2R | 15145383..15145440 | 17..74 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:28:33 Download gff for
BO24584.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2R | 11032684..11032776 | 75..167 | 100 | <- | Minus |
| arm_2R | 11032888..11032945 | 17..74 | 100 | | Minus |
BO24584.pep Sequence
Translation from 16 to 205
> BO24584.pep
MSETSSKDNVKTAMTYICGECHHENEMRPRDPIRCRECGYRIMYKKRTKR
LVVFDARASFLDH
BO24584.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 04:58:27
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Rpb12-PA | 57 | CG34186-PA | 1..57 | 1..57 | 313 | 100 | Plus |
