Clone BO24586 Report

Search the DGRC for BO24586

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:245
Well:86
Vector:pDNR-Dual
Associated Gene/TranscriptCG34229-RA
Protein status:BO24586.pep: Imported from assembly
Sequenced Size:304

Clone Sequence Records

BO24586.complete Sequence

304 bp assembled on 2010-05-18

GenBank Submission: KX796664

> BO24586.complete
GAAGTTATCAGTCGACATGTCCAAGTTACCAAAAGCATCACTTAGTTTGA
AGCAGTTTATGCTGCGCCAGGAAGTACTGAAGCTCTACCGGGAAATATTT
CGAACGATTCGTCAGGTTCCCGACAAAAACAGCCAGCTGGAGCTAAAATC
CTGGGCACGGCATGACTTCCAGACGAATCGCCATCAAAGTGACGAGGTGG
CCATCAAGATGCTCCTTCAGCACGGCAGACGCAGCCTCACAGAACTAAGG
ACCAGCCTCCAACTGAGCGGGGTGAGCGAGGGCAAAGCAAGCTTTCTAGA
CCAT

BO24586.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:47:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG34229-RA 273 CG34229-PA 1..270 17..286 1350 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:47:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG34229-RA 474 CG34229-RA 117..386 17..286 1350 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:47:51
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11841844..11842076 54..286 1165 100 Plus
2R 25286936 2R 11841724..11841762 17..55 195 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:47:53 has no hits.

BO24586.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-18 11:29:40 Download gff for BO24586.complete
Subject Subject Range Query Range Percent Splice Strand
CG34229-RA 1..270 17..288 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:27:33 Download gff for BO24586.complete
Subject Subject Range Query Range Percent Splice Strand
CG34229-RA 117..386 17..288 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:36:13 Download gff for BO24586.complete
Subject Subject Range Query Range Percent Splice Strand
CG34229-RA 117..386 17..288 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:36:13 Download gff for BO24586.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11841846..11842076 56..288 99   Plus
2R 11841724..11841762 17..55 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:27:33 Download gff for BO24586.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7729229..7729267 17..55 100 -> Plus
arm_2R 7729351..7729581 56..288 99   Plus

BO24586.pep Sequence

Translation from 16 to 304

> BO24586.pep
MSKLPKASLSLKQFMLRQEVLKLYREIFRTIRQVPDKNSQLELKSWARHD
FQTNRHQSDEVAIKMLLQHGRRSLTELRTSLQLSGVSEGKASFLDH

BO24586.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:59:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG34229-PA 90 CG34229-PA 1..90 1..90 448 100 Plus