BO24590.complete Sequence
295 bp assembled on 2010-05-18
> BO24590.complete
GAAGTTATCAGTCGACATGTGGGGCTATCATTTGCCAATTGTGCTGCGCC
CAGCCAACAATATGACCATCACGAGCGGAGGCAACAGCTACAGTCCTCGA
AACTCCGTGGAAAACGACGCCTGGACGCTTGGTGAATCCTCCGAGTATGG
TGAATATCCCGATGACTACGATGAAAACGATGAGGAGCACGGCGATGAGG
ATATTGACTACGTTGGCCAGGAATCCGACGATGTTTTCGAAACGGAATCT
GGAGAGGCTGCAGTTCAGGGCGCACAGGCAAGCTTTCTAGACCAT
BO24590.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:47:59
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG42671-RL | 3909 | CG42671-PL | 3669..3906 | 40..277 | 1190 | 100 | Plus |
| CG42671-RK | 3909 | CG42671-PK | 3669..3906 | 40..277 | 1190 | 100 | Plus |
| CG42671-RD | 3906 | CG42671-PD | 3666..3903 | 40..277 | 1190 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:48:00
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG42671-RJ | 5900 | CG42671-RJ | 4478..4738 | 17..277 | 1305 | 100 | Plus |
| CG42671-RH | 4879 | CG42671-RH | 4334..4594 | 17..277 | 1305 | 100 | Plus |
| CG42671-RG | 4917 | CG42671-RG | 4372..4632 | 17..277 | 1305 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:47:57
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3L | 28110227 | 3L | 11229113..11229350 | 40..277 | 1190 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 02:47:58 has no hits.
BO24590.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-18 11:29:41 Download gff for
BO24590.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG34240-RA | 251..511 | 17..279 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:27:36 Download gff for
BO24590.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG42671-RG | 4372..4632 | 17..279 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:36:14 Download gff for
BO24590.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG42671-RG | 4372..4632 | 17..279 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:36:14 Download gff for
BO24590.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3L | 11228066..11228088 | 17..39 | 100 | -> | Plus |
| 3L | 11229113..11229350 | 40..279 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:27:36 Download gff for
BO24590.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3L | 11221166..11221188 | 17..39 | 100 | -> | Plus |
| arm_3L | 11222213..11222450 | 40..279 | 99 | | Plus |
BO24590.pep Sequence
Translation from 16 to 295
> BO24590.pep
MWGYHLPIVLRPANNMTITSGGNSYSPRNSVENDAWTLGESSEYGEYPDD
YDENDEEHGDEDIDYVGQESDDVFETESGEAAVQGAQASFLDH
BO24590.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:59:08
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG42671-PD | 1301 | CG42671-PD | 1223..1301 | 9..87 | 423 | 100 | Plus |
| CG42671-PF | 1301 | CG42671-PF | 1223..1301 | 9..87 | 423 | 100 | Plus |
| CG42671-PL | 1302 | CG42671-PL | 1224..1302 | 9..87 | 423 | 100 | Plus |
| CG42671-PK | 1302 | CG42671-PK | 1224..1302 | 9..87 | 423 | 100 | Plus |
