Clone BO24593 Report

Search the DGRC for BO24593

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:245
Well:93
Vector:pDNR-Dual
Associated Gene/TranscriptCG34247-RA
Protein status:BO24593.pep: Imported from assembly
Sequenced Size:283

Clone Sequence Records

BO24593.complete Sequence

283 bp assembled on 2010-05-18

GenBank Submission: KX796298

> BO24593.complete
GAAGTTATCAGTCGACATGAAGCTGCTGATCTTTGCCTGTTTGCTTGCTC
TGGCTTTGGGGCACGAGGTGTATTACTATACCCCCAGCTATGGGTACTAC
CCCAGTACCTTTGCCAGGTCCTCGGCTGTCCTGCCCTTGGCCTATTCCCG
TTTGATTGCCCCGGCAGCCGCCGAATCGCATCTTTACCACAGCGTGGAGA
CCCCGAACTCCTTCCAGCAGCAATATCGCAGCGACTACAAGCCCCTGACC
TATGAGTACATCTACGCAAGCTTTCTAGACCAT

BO24593.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:46:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG34247-RA 252 CG34247-PA 1..249 17..265 1245 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:46:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG34247-RA 353 CG34247-RA 30..278 17..265 1245 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:46:34
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16261260..16261500 265..25 1205 100 Minus
Blast to na_te.dros performed on 2014-11-28 02:46:35 has no hits.

BO24593.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-18 11:29:14 Download gff for BO24593.complete
Subject Subject Range Query Range Percent Splice Strand
CG34247-RA 1..249 17..267 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:27:08 Download gff for BO24593.complete
Subject Subject Range Query Range Percent Splice Strand
CG34247-RA 30..278 17..267 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:35:47 Download gff for BO24593.complete
Subject Subject Range Query Range Percent Splice Strand
CG34247-RA 30..278 17..267 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:35:47 Download gff for BO24593.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16261258..16261505 17..267 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:27:08 Download gff for BO24593.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16254358..16254605 17..267 97   Minus

BO24593.pep Sequence

Translation from 16 to 283

> BO24593.pep
MKLLIFACLLALALGHEVYYYTPSYGYYPSTFARSSAVLPLAYSRLIAPA
AAESHLYHSVETPNSFQQQYRSDYKPLTYEYIYASFLDH

BO24593.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:57:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG34247-PA 83 CG34247-PA 1..83 1..83 437 100 Plus