BO24620.complete Sequence
220 bp assembled on 2010-05-21
GenBank Submission: KX799436
> BO24620.complete
GAAGTTATCAGTCGACATGGCTGGATCACCTGGCGTTAAGGATAAGCTGA
ATCTGATTGTTGGCGGGGACATTTGCGAGGTATACCGGGATGGATTCAAT
TGCGGATCCTTTGGCTTCTGGTGCGGACTCGTCGGATTGGCCGTCTTCAT
AATTTTTCTCGCCTACTTTCATATAAATCGGGAGCGAATAGATCCGACGT
CAGCAAGCTTTCTAGACCAT
BO24620.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:49:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34170-RB | 189 | CG34170-PB | 1..186 | 17..202 | 930 | 100 | Plus |
CG34170-RA | 189 | CG34170-PA | 1..186 | 17..202 | 930 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:49:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34170-RB | 353 | CG34170-RB | 61..247 | 16..202 | 935 | 100 | Plus |
CG34170-RA | 314 | CG34170-RA | 61..247 | 16..202 | 935 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:49:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 17311574..17311760 | 202..16 | 935 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 02:49:37 has no hits.
BO24620.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-21 14:40:44 Download gff for
BO24620.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34170-RA | 62..247 | 17..204 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:28:14 Download gff for
BO24620.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34170-RA | 62..247 | 17..204 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:36:48 Download gff for
BO24620.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34170-RA | 62..247 | 17..204 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:36:48 Download gff for
BO24620.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 17311572..17311759 | 17..204 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:28:14 Download gff for
BO24620.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 17311572..17311759 | 17..204 | 98 | | Minus |
BO24620.pep Sequence
Translation from 16 to 220
> BO24620.pep
MAGSPGVKDKLNLIVGGDICEVYRDGFNCGSFGFWCGLVGLAVFIIFLAY
FHINRERIDPTSASFLDH
BO24620.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 03:05:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34170-PB | 62 | CG34170-PB | 1..62 | 1..62 | 339 | 100 | Plus |
CG34170-PA | 62 | CG34170-PA | 1..62 | 1..62 | 339 | 100 | Plus |