Clone BO24620 Report

Search the DGRC for BO24620

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:246
Well:20
Vector:pDNR-Dual
Associated Gene/TranscriptCG34170-RA
Protein status:BO24620.pep: Imported from assembly
Sequenced Size:220

Clone Sequence Records

BO24620.complete Sequence

220 bp assembled on 2010-05-21

GenBank Submission: KX799436

> BO24620.complete
GAAGTTATCAGTCGACATGGCTGGATCACCTGGCGTTAAGGATAAGCTGA
ATCTGATTGTTGGCGGGGACATTTGCGAGGTATACCGGGATGGATTCAAT
TGCGGATCCTTTGGCTTCTGGTGCGGACTCGTCGGATTGGCCGTCTTCAT
AATTTTTCTCGCCTACTTTCATATAAATCGGGAGCGAATAGATCCGACGT
CAGCAAGCTTTCTAGACCAT

BO24620.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:49:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG34170-RB 189 CG34170-PB 1..186 17..202 930 100 Plus
CG34170-RA 189 CG34170-PA 1..186 17..202 930 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:49:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG34170-RB 353 CG34170-RB 61..247 16..202 935 100 Plus
CG34170-RA 314 CG34170-RA 61..247 16..202 935 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:49:36
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 17311574..17311760 202..16 935 100 Minus
Blast to na_te.dros performed on 2014-11-28 02:49:37 has no hits.

BO24620.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-21 14:40:44 Download gff for BO24620.complete
Subject Subject Range Query Range Percent Splice Strand
CG34170-RA 62..247 17..204 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:28:14 Download gff for BO24620.complete
Subject Subject Range Query Range Percent Splice Strand
CG34170-RA 62..247 17..204 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:36:48 Download gff for BO24620.complete
Subject Subject Range Query Range Percent Splice Strand
CG34170-RA 62..247 17..204 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:36:48 Download gff for BO24620.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17311572..17311759 17..204 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:28:14 Download gff for BO24620.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 17311572..17311759 17..204 98   Minus

BO24620.pep Sequence

Translation from 16 to 220

> BO24620.pep
MAGSPGVKDKLNLIVGGDICEVYRDGFNCGSFGFWCGLVGLAVFIIFLAY
FHINRERIDPTSASFLDH

BO24620.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 03:05:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG34170-PB 62 CG34170-PB 1..62 1..62 339 100 Plus
CG34170-PA 62 CG34170-PA 1..62 1..62 339 100 Plus