Clone BO24665 Report

Search the DGRC for BO24665

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:246
Well:65
Vector:pDNR-Dual
Associated Gene/TranscriptCG34301-RA
Protein status:BO24665.pep: Imported from assembly
Sequenced Size:289

Clone Sequence Records

BO24665.complete Sequence

289 bp assembled on 2010-05-21

GenBank Submission: KX793902

> BO24665.complete
GAAGTTATCAGTCGACATGGGTCACCTGCAGTTGGATTTCCATTCCATAC
CTAAGCTCCATGGCAGGGAGAACTATTGGCAGTGGCGCATCCTCCTGAAG
ACCTTTCTGGAGGCCAACGATCTGTGGAAGCACAACGAACCGAAGGAGAG
CCCAGAAACCAAATTCCTGATTTTGGCCAGCGTTACGGCCGATAAGATTG
AGCCATCCTACGATGATCAAAGCTGTTCGTACATTTTCCAAAACATGGAG
AGTCGATTCGGGCCTTTTAGTGCAAGCTTTCTAGACCAT

BO24665.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:49:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG34301-RA 258 CG34301-PA 1..255 17..271 1275 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:49:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG34301-RA 307 CG34301-RA 6..264 13..271 1280 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:49:46
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8773440..8773575 13..148 665 99.3 Plus
3R 32079331 3R 8773643..8773767 147..271 625 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:49:48 has no hits.

BO24665.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-21 14:40:46 Download gff for BO24665.complete
Subject Subject Range Query Range Percent Splice Strand
CG34301-RA 10..264 17..273 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:28:19 Download gff for BO24665.complete
Subject Subject Range Query Range Percent Splice Strand
CG34301-RA 10..264 17..273 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:36:52 Download gff for BO24665.complete
Subject Subject Range Query Range Percent Splice Strand
CG34301-RA 10..264 17..273 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:36:52 Download gff for BO24665.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8773444..8773575 17..148 100 -> Plus
3R 8773645..8773767 149..273 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:28:19 Download gff for BO24665.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4599166..4599297 17..148 100 -> Plus
arm_3R 4599367..4599489 149..273 98   Plus

BO24665.pep Sequence

Translation from 16 to 289

> BO24665.pep
MGHLQLDFHSIPKLHGRENYWQWRILLKTFLEANDLWKHNEPKESPETKF
LILASVTADKIEPSYDDQSCSYIFQNMESRFGPFSASFLDH

BO24665.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:59:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG34301-PA 85 CG34301-PA 1..85 1..85 467 100 Plus
CG42446-PA 123 CG42446-PA 39..109 11..81 169 42.3 Plus