Clone BO24670 Report

Search the DGRC for BO24670

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:246
Well:70
Vector:pDNR-Dual
Associated Gene/TranscriptCG34165-RA
Protein status:BO24670.pep: Imported from assembly
Sequenced Size:331

Clone Sequence Records

BO24670.complete Sequence

331 bp assembled on 2010-05-21

GenBank Submission: KX799699

> BO24670.complete
GAAGTTATCAGTCGACATGAAATTCACGATAATCGTTTTTGTTGCGCTCC
TCGCCTTTGCATCGGCCCAGTTCGGTCCGTTTGGTCAAATTATTAGGGGT
ATTGAACGATTTGAAGGTGGTCTGCAACAACAACAGCAGCAGCAGCAAAG
CGGCTTTGGCGGTGGTCAGCAGCAGCAACAGCAGGAGGAGGGTGTCATCT
TCAGAGGTCCTTTCGGCGGCGGAGTGGAGTTCTTCCAGGAGCAACAGCAG
CAGCAGCAAGGCGGTGGAGGTCAGCAGCAACAGCAGCAGGAGAACCTATT
TAACTTCTTCGGCGCAAGCTTTCTAGACCAT

BO24670.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:49:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG34165-RB 300 CG34165-PB 1..297 17..313 1485 100 Plus
CG34165-RA 300 CG34165-PA 1..297 17..313 1485 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:49:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG34165-RB 686 CG34165-RB 78..383 15..320 1500 99.3 Plus
CG34165-RA 515 CG34165-RA 78..383 15..320 1500 99.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:49:51
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 14713931..14714223 28..320 1435 99.3 Plus
Blast to na_te.dros performed on 2014-11-28 02:49:52 has no hits.

BO24670.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-21 14:40:47 Download gff for BO24670.complete
Subject Subject Range Query Range Percent Splice Strand
CG34165-RA 1..297 17..315 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:28:20 Download gff for BO24670.complete
Subject Subject Range Query Range Percent Splice Strand
CG34165-RA 80..376 17..315 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:36:54 Download gff for BO24670.complete
Subject Subject Range Query Range Percent Splice Strand
CG34165-RA 80..376 17..315 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:36:54 Download gff for BO24670.complete
Subject Subject Range Query Range Percent Splice Strand
2L 14713927..14714216 23..315 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:28:20 Download gff for BO24670.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 14713927..14714216 23..315 98   Plus

BO24670.pep Sequence

Translation from 16 to 331

> BO24670.pep
MKFTIIVFVALLAFASAQFGPFGQIIRGIERFEGGLQQQQQQQQSGFGGG
QQQQQQEEGVIFRGPFGGGVEFFQEQQQQQQGGGGQQQQQQENLFNFFGA
SFLDH

BO24670.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:59:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG34165-PB 99 CG34165-PB 1..99 1..99 514 100 Plus
CG34165-PA 99 CG34165-PA 1..99 1..99 514 100 Plus
CG31775-PB 89 CG31775-PB 1..87 1..92 183 51.5 Plus
CG31775-PA 89 CG31775-PA 1..87 1..92 183 51.5 Plus
CG42586-PB 89 CG42586-PB 1..87 1..92 183 51.5 Plus