BO24670.complete Sequence
331 bp assembled on 2010-05-21
GenBank Submission: KX799699
> BO24670.complete
GAAGTTATCAGTCGACATGAAATTCACGATAATCGTTTTTGTTGCGCTCC
TCGCCTTTGCATCGGCCCAGTTCGGTCCGTTTGGTCAAATTATTAGGGGT
ATTGAACGATTTGAAGGTGGTCTGCAACAACAACAGCAGCAGCAGCAAAG
CGGCTTTGGCGGTGGTCAGCAGCAGCAACAGCAGGAGGAGGGTGTCATCT
TCAGAGGTCCTTTCGGCGGCGGAGTGGAGTTCTTCCAGGAGCAACAGCAG
CAGCAGCAAGGCGGTGGAGGTCAGCAGCAACAGCAGCAGGAGAACCTATT
TAACTTCTTCGGCGCAAGCTTTCTAGACCAT
BO24670.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:49:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34165-RB | 300 | CG34165-PB | 1..297 | 17..313 | 1485 | 100 | Plus |
CG34165-RA | 300 | CG34165-PA | 1..297 | 17..313 | 1485 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:49:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34165-RB | 686 | CG34165-RB | 78..383 | 15..320 | 1500 | 99.3 | Plus |
CG34165-RA | 515 | CG34165-RA | 78..383 | 15..320 | 1500 | 99.3 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:49:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 14713931..14714223 | 28..320 | 1435 | 99.3 | Plus |
Blast to na_te.dros performed on 2014-11-28 02:49:52 has no hits.
BO24670.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-21 14:40:47 Download gff for
BO24670.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34165-RA | 1..297 | 17..315 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:28:20 Download gff for
BO24670.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34165-RA | 80..376 | 17..315 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:36:54 Download gff for
BO24670.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34165-RA | 80..376 | 17..315 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:36:54 Download gff for
BO24670.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 14713927..14714216 | 23..315 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:28:20 Download gff for
BO24670.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 14713927..14714216 | 23..315 | 98 | | Plus |
BO24670.pep Sequence
Translation from 16 to 331
> BO24670.pep
MKFTIIVFVALLAFASAQFGPFGQIIRGIERFEGGLQQQQQQQQSGFGGG
QQQQQQEEGVIFRGPFGGGVEFFQEQQQQQQGGGGQQQQQQENLFNFFGA
SFLDH
BO24670.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:59:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34165-PB | 99 | CG34165-PB | 1..99 | 1..99 | 514 | 100 | Plus |
CG34165-PA | 99 | CG34165-PA | 1..99 | 1..99 | 514 | 100 | Plus |
CG31775-PB | 89 | CG31775-PB | 1..87 | 1..92 | 183 | 51.5 | Plus |
CG31775-PA | 89 | CG31775-PA | 1..87 | 1..92 | 183 | 51.5 | Plus |
CG42586-PB | 89 | CG42586-PB | 1..87 | 1..92 | 183 | 51.5 | Plus |