Clone BO24673 Report

Search the DGRC for BO24673

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:246
Well:73
Vector:pDNR-Dual
Associated Gene/TranscriptCG34132-RA
Protein status:BO24673.pep: Imported from assembly
Sequenced Size:286

Clone Sequence Records

BO24673.complete Sequence

286 bp assembled on 2010-05-24

GenBank Submission: KX798243

> BO24673.complete
GAAGTTATCAGTCGACATGGCTATGGCTAATGTGGACAAAGGTGAACTTA
TGGACCAGGTTAAGCAACAGATTGCTGTTGCGAATGCCCAGGAATTGCTC
ACGCAAATGACCGAAAAGTGCTTCAAAAAATGTGTCAATAAGCCGGGAAC
TTCCCTCGATTCGTCCGAACAGAAATGCATTTCCATGTGCATGGACCGGT
TTATGGACTCGTGGAACCTCATTTCTCGGGTGTACGGCCAAAGAATACAA
CGTGAACAATCCAAGTTCGCAAGCTTTCTAGACCAT

BO24673.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:41:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG34132-RA 255 CG34132-PA 1..252 17..268 1260 100 Plus
Tim13-RA 279 CG11611-PA 17..200 33..216 260 76.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:41:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG34132-RA 535 CG34132-RA 147..398 17..268 1260 100 Plus
Tim13-RA 442 CG11611-RA 106..289 33..216 260 76.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:41:12
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7885649..7885804 17..172 780 100 Plus
2L 23513712 2L 7885875..7885972 171..268 490 100 Plus
3L 28110227 3L 11774213..11774396 216..33 260 76.1 Minus
Blast to na_te.dros performed on 2014-11-27 01:41:13 has no hits.

BO24673.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-24 09:52:03 Download gff for BO24673.complete
Subject Subject Range Query Range Percent Splice Strand
CG34132-RA 1..252 17..270 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:59:39 Download gff for BO24673.complete
Subject Subject Range Query Range Percent Splice Strand
CG34132-RA 147..398 17..270 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:30:02 Download gff for BO24673.complete
Subject Subject Range Query Range Percent Splice Strand
CG34132-RA 147..398 17..270 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:30:02 Download gff for BO24673.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7885649..7885804 17..172 100 -> Plus
2L 7885877..7885972 173..270 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:59:39 Download gff for BO24673.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 7885649..7885804 17..172 100 -> Plus
arm_2L 7885877..7885972 173..270 97   Plus

BO24673.pep Sequence

Translation from 16 to 286

> BO24673.pep
MAMANVDKGELMDQVKQQIAVANAQELLTQMTEKCFKKCVNKPGTSLDSS
EQKCISMCMDRFMDSWNLISRVYGQRIQREQSKFASFLDH

BO24673.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 04:58:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG34132-PA 84 CG34132-PA 1..84 1..84 435 100 Plus
Tim13-PA 92 CG11611-PA 1..89 1..89 351 70.8 Plus
CG42302-PA 121 CG42302-PA 8..77 12..81 175 44.3 Plus
Tim8-PB 88 CG1728-PB 20..82 15..79 135 38.5 Plus
Tim8-PA 88 CG1728-PA 20..82 15..79 135 38.5 Plus