BO24673.complete Sequence
286 bp assembled on 2010-05-24
GenBank Submission: KX798243
> BO24673.complete
GAAGTTATCAGTCGACATGGCTATGGCTAATGTGGACAAAGGTGAACTTA
TGGACCAGGTTAAGCAACAGATTGCTGTTGCGAATGCCCAGGAATTGCTC
ACGCAAATGACCGAAAAGTGCTTCAAAAAATGTGTCAATAAGCCGGGAAC
TTCCCTCGATTCGTCCGAACAGAAATGCATTTCCATGTGCATGGACCGGT
TTATGGACTCGTGGAACCTCATTTCTCGGGTGTACGGCCAAAGAATACAA
CGTGAACAATCCAAGTTCGCAAGCTTTCTAGACCAT
BO24673.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:41:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34132-RA | 255 | CG34132-PA | 1..252 | 17..268 | 1260 | 100 | Plus |
Tim13-RA | 279 | CG11611-PA | 17..200 | 33..216 | 260 | 76.1 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:41:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34132-RA | 535 | CG34132-RA | 147..398 | 17..268 | 1260 | 100 | Plus |
Tim13-RA | 442 | CG11611-RA | 106..289 | 33..216 | 260 | 76.1 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:41:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 7885649..7885804 | 17..172 | 780 | 100 | Plus |
2L | 23513712 | 2L | 7885875..7885972 | 171..268 | 490 | 100 | Plus |
3L | 28110227 | 3L | 11774213..11774396 | 216..33 | 260 | 76.1 | Minus |
Blast to na_te.dros performed on 2014-11-27 01:41:13 has no hits.
BO24673.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-24 09:52:03 Download gff for
BO24673.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34132-RA | 1..252 | 17..270 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:59:39 Download gff for
BO24673.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34132-RA | 147..398 | 17..270 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:30:02 Download gff for
BO24673.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34132-RA | 147..398 | 17..270 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:30:02 Download gff for
BO24673.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 7885649..7885804 | 17..172 | 100 | -> | Plus |
2L | 7885877..7885972 | 173..270 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:59:39 Download gff for
BO24673.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 7885649..7885804 | 17..172 | 100 | -> | Plus |
arm_2L | 7885877..7885972 | 173..270 | 97 | | Plus |
BO24673.pep Sequence
Translation from 16 to 286
> BO24673.pep
MAMANVDKGELMDQVKQQIAVANAQELLTQMTEKCFKKCVNKPGTSLDSS
EQKCISMCMDRFMDSWNLISRVYGQRIQREQSKFASFLDH
BO24673.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 04:58:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34132-PA | 84 | CG34132-PA | 1..84 | 1..84 | 435 | 100 | Plus |
Tim13-PA | 92 | CG11611-PA | 1..89 | 1..89 | 351 | 70.8 | Plus |
CG42302-PA | 121 | CG42302-PA | 8..77 | 12..81 | 175 | 44.3 | Plus |
Tim8-PB | 88 | CG1728-PB | 20..82 | 15..79 | 135 | 38.5 | Plus |
Tim8-PA | 88 | CG1728-PA | 20..82 | 15..79 | 135 | 38.5 | Plus |