BO24683.complete Sequence
265 bp assembled on 2010-05-21
GenBank Submission: KX795927
> BO24683.complete
GAAGTTATCAGTCGACATGTGGCCCAACTTTTTGGCTGTCGTTTCCCTAC
TGTGCCTTGCATTCTTCGCTTGGGCAAAAGCTGGACCTGTGCCAATTGTG
AATGAGCACCAACAATTGATGCCGAAAGTGCCTCAATGGCACTGCCTGCG
CTACTTTAAGCATGATGTCCTGATGATGCGCCGCTGTCGCCACTTGCGAG
TCCCTACAGCGCCACGACTGGGCGATGTCCTCAAGCGAAAGAAGAAAGCA
AGCTTTCTAGACCAT
BO24683.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:48:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34136-RA | 234 | CG34136-PA | 1..231 | 17..247 | 1155 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:48:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34136-RA | 706 | CG34136-RA | 268..498 | 17..247 | 1155 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:48:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 21098582..21098724 | 105..247 | 715 | 100 | Plus |
2L | 23513712 | 2L | 21097189..21097278 | 17..106 | 450 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 02:48:03 has no hits.
BO24683.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-21 14:40:39 Download gff for
BO24683.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34136-RA | 268..488 | 17..237 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:27:38 Download gff for
BO24683.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34136-RA | 268..488 | 17..237 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:36:16 Download gff for
BO24683.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34136-RA | 268..488 | 17..237 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:36:16 Download gff for
BO24683.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 21097189..21097278 | 17..106 | 100 | -> | Plus |
2L | 21098584..21098714 | 107..237 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:27:38 Download gff for
BO24683.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 21097189..21097278 | 17..106 | 100 | -> | Plus |
arm_2L | 21098584..21098714 | 107..237 | 100 | | Plus |
BO24683.pep Sequence
Translation from 16 to 265
> BO24683.pep
MWPNFLAVVSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKKASFLDH
BO24683.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:59:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34136-PA | 77 | CG34136-PA | 1..77 | 1..77 | 427 | 100 | Plus |