Clone BO24683 Report

Search the DGRC for BO24683

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:246
Well:83
Vector:pDNR-Dual
Associated Gene/TranscriptCG34136-RA
Protein status:BO24683.pep: Imported from assembly
Sequenced Size:265

Clone Sequence Records

BO24683.complete Sequence

265 bp assembled on 2010-05-21

GenBank Submission: KX795927

> BO24683.complete
GAAGTTATCAGTCGACATGTGGCCCAACTTTTTGGCTGTCGTTTCCCTAC
TGTGCCTTGCATTCTTCGCTTGGGCAAAAGCTGGACCTGTGCCAATTGTG
AATGAGCACCAACAATTGATGCCGAAAGTGCCTCAATGGCACTGCCTGCG
CTACTTTAAGCATGATGTCCTGATGATGCGCCGCTGTCGCCACTTGCGAG
TCCCTACAGCGCCACGACTGGGCGATGTCCTCAAGCGAAAGAAGAAAGCA
AGCTTTCTAGACCAT

BO24683.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:48:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG34136-RA 234 CG34136-PA 1..231 17..247 1155 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:48:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG34136-RA 706 CG34136-RA 268..498 17..247 1155 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:48:02
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 21098582..21098724 105..247 715 100 Plus
2L 23513712 2L 21097189..21097278 17..106 450 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:48:03 has no hits.

BO24683.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-21 14:40:39 Download gff for BO24683.complete
Subject Subject Range Query Range Percent Splice Strand
CG34136-RA 268..488 17..237 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:27:38 Download gff for BO24683.complete
Subject Subject Range Query Range Percent Splice Strand
CG34136-RA 268..488 17..237 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:36:16 Download gff for BO24683.complete
Subject Subject Range Query Range Percent Splice Strand
CG34136-RA 268..488 17..237 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:36:16 Download gff for BO24683.complete
Subject Subject Range Query Range Percent Splice Strand
2L 21097189..21097278 17..106 100 -> Plus
2L 21098584..21098714 107..237 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:27:38 Download gff for BO24683.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 21097189..21097278 17..106 100 -> Plus
arm_2L 21098584..21098714 107..237 100   Plus

BO24683.pep Sequence

Translation from 16 to 265

> BO24683.pep
MWPNFLAVVSLLCLAFFAWAKAGPVPIVNEHQQLMPKVPQWHCLRYFKHD
VLMMRRCRHLRVPTAPRLGDVLKRKKKASFLDH

BO24683.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:59:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG34136-PA 77 CG34136-PA 1..77 1..77 427 100 Plus