Clone BO24689 Report

Search the DGRC for BO24689

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:246
Well:89
Vector:pDNR-Dual
Associated Gene/TranscriptCG34264-RB
Protein status:BO24689.pep: Imported from assembly
Sequenced Size:385

Clone Sequence Records

BO24689.complete Sequence

385 bp assembled on 2010-05-24

GenBank Submission: KX796895

> BO24689.complete
GAAGTTATCAGTCGACATGGCGCGTTCCCAGTCGAAAATGATTCGGGCCG
CCATGGTCGTGGACGACCCTAATATGGTGGCCTGGCTGCCATACCTTAAC
TTTCTTCGCTTTCTGAAGCGAAACTTCTATCCCAGGACTGATTTGCGCCG
CTTACTTCAGGTGGGACTCATCCGTTGGATCGCACTTAGCGATGCCCAGA
AGAGGTTATTTGAGCCAGAACGAATCCTGGCGCGTGTGGCTCGCAGGCAA
AGGAATAAACGACGCCGCCGACTACTTCGCCGTGCTCGGCATGGCCAGAA
AGGACGTGGTGCAGTGCGACGCCCCATCTACGACAGCCGTCCTAAACCGA
GACGCCGCAAACCGAAGGCAAGCTTTCTAGACCAT

BO24689.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:39:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG34264-RC 354 CG34264-PC 1..351 17..367 1740 99.7 Plus
CG34264-RB 354 CG34264-PB 1..351 17..367 1740 99.7 Plus
CG34264-RD 345 CG34264-PD 1..335 17..367 1465 95.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:40:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG34264-RC 563 CG34264-RC 125..475 17..367 1740 99.7 Plus
CG34264-RB 587 CG34264-RB 122..472 17..367 1740 99.7 Plus
CG34264-RD 547 CG34264-RD 125..459 17..367 1465 95.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:39:55
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 317208..317411 17..220 1020 100 Plus
3L 28110227 3L 317465..317611 221..367 720 99.3 Plus
Blast to na_te.dros performed on 2014-11-27 01:39:56 has no hits.

BO24689.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-24 10:02:27 Download gff for BO24689.complete
Subject Subject Range Query Range Percent Splice Strand
CG34264-RB 122..472 17..369 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:59:17 Download gff for BO24689.complete
Subject Subject Range Query Range Percent Splice Strand
CG34264-RB 122..472 17..369 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:29:46 Download gff for BO24689.complete
Subject Subject Range Query Range Percent Splice Strand
CG34264-RB 122..472 17..369 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:29:46 Download gff for BO24689.complete
Subject Subject Range Query Range Percent Splice Strand
3L 317208..317411 17..220 100 -> Plus
3L 317465..317611 221..369 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:59:17 Download gff for BO24689.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 317208..317411 17..220 100 -> Plus
arm_3L 317465..317611 221..369 97   Plus

BO24689.pep Sequence

Translation from 16 to 385

> BO24689.pep
MARSQSKMIRAAMVVDDPNMVAWLPYLNFLRFLKRNFYPRTDLRRLLQVG
LIRWIALSDAQKRLFEPERILARVARRQRNKRRRRLLRRARHGQKGRGAV
RRPIYDSRPKPRRRKPKASFLDH

BO24689.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 04:58:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG34264-PC 117 CG34264-PC 1..117 1..117 601 100 Plus
CG34264-PB 117 CG34264-PB 1..117 1..117 601 100 Plus
CG34264-PD 114 CG34264-PD 1..62 1..62 318 100 Plus