Clone BO24718 Report

Search the DGRC for BO24718

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:247
Well:18
Vector:pDNR-Dual
Associated Gene/Transcript
Protein status:BO24718.pep: Imported from assembly
Sequenced Size:358

Clone Sequence Records

BO24718.complete Sequence

358 bp assembled on 2010-05-17

> BO24718.complete
GAAGTTATCAGTCGACATGATGTTCCGCTCCGTGATCCCAGTTCTCCTGT
TCCTGATCCCGCTCCTGCTATCCGCCCAGGCCGCAAACTCGCTGCGGGCT
TGTGGCCCCGCCTTGATGGACATGCTGAGGGTTGCCTGTCCCAATGGATT
CAATTCAATGTTCGCCAAACGAGGCACCTTGGGCCTATTCGATTATGAGG
ACCACTTGGCGGATTTGGATAGCTCCGAATCTCACCACATGAACTCACTG
TCGAGCATTCGGCGCGATTTTCGCGGCGTTGTCGACTCCTGTTGCCGCAA
ATCGTGTTCCTTTTCCACGTTGAGGGCATACTGCGACTCCGCAAGCTTTC
TAGACCAT

BO24718.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:35:22
Subject Length Description Subject Range Query Range Score Percent Strand
Ilp5-RA 324 CG33273-PA 1..321 20..340 1605 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:35:23
Subject Length Description Subject Range Query Range Score Percent Strand
Ilp5-RA 478 CG33273-RA 25..348 17..340 1620 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:35:19
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9823711..9823873 179..17 815 100 Minus
3L 28110227 3L 9823479..9823639 340..180 805 100 Minus
Blast to na_te.dros performed on 2014-11-28 02:35:21 has no hits.

BO24718.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-17 10:58:17 Download gff for BO24718.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp5-RA 1..321 20..342 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:22:56 Download gff for BO24718.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp5-RA 25..348 17..342 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:32:13 Download gff for BO24718.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp5-RA 25..348 17..342 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:32:13 Download gff for BO24718.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9823477..9823639 180..342 98 <- Minus
3L 9823711..9823873 17..179 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:22:56 Download gff for BO24718.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9816577..9816739 180..342 98 <- Minus
arm_3L 9816811..9816973 17..179 100   Minus

BO24718.pep Sequence

Translation from 16 to 358

> BO24718.pep
MMFRSVIPVLLFLIPLLLSAQAANSLRACGPALMDMLRVACPNGFNSMFA
KRGTLGLFDYEDHLADLDSSESHHMNSLSSIRRDFRGVVDSCCRKSCSFS
TLRAYCDSASFLDH

BO24718.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:43:02
Subject Length Description Subject Range Query Range Score Percent Strand
Ilp5-PA 107 CG33273-PA 1..107 2..108 557 100 Plus