Clone BO24730 Report

Search the DGRC for BO24730

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:247
Well:30
Vector:pDNR-Dual
Associated Gene/TranscriptCG15577-RA
Protein status:BO24730.pep: Imported from assembly
Sequenced Size:331

Clone Sequence Records

BO24730.complete Sequence

331 bp assembled on 2010-05-17

GenBank Submission: KX797241

> BO24730.complete
GAAGTTATCAGTCGACATGCCCGTCACCTACAGGACTCGCACACTGCCGC
AACAGCGGAAGTTGGTCCCCAACCTACTGAGGTCCATACTACGCGTCCTG
GAGGAGACGCGCCGACCCATGAGTGACAAAGAGTTGAACTTCGTCCTGGG
CGTCCAGTACCGACGCAACGATCCGGAGTTCTATCGCCAAGTGCAAGTCA
ACCTGCGCGATGGCGTCGAATACGGCATTCTGAAACGCCAGGGAAACCAG
TTTTCGCTGCGATCCCGACGCCTTGGTGAACTGATGTCTACTCTTGGATC
CTCGCCAAACCGCGCAAGCTTTCTAGACCAT

BO24730.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:33:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG15577-RA 300 CG15577-PA 1..297 17..313 1485 100 Plus
CG15578-RA 270 CG15578-PA 36..235 61..260 475 82.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:33:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG15577-RA 508 CG15577-RA 94..391 16..313 1490 100 Plus
CG15578-RA 415 CG15578-RA 135..334 61..260 475 82.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:33:25
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4276610..4276907 313..16 1490 100 Minus
X 23542271 X 4277628..4277827 260..61 475 82.5 Minus
Blast to na_te.dros performed on 2014-11-28 02:33:26 has no hits.

BO24730.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-17 10:58:07 Download gff for BO24730.complete
Subject Subject Range Query Range Percent Splice Strand
CG15577-RA 1..297 17..315 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:22:12 Download gff for BO24730.complete
Subject Subject Range Query Range Percent Splice Strand
CG15577-RA 95..391 17..315 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:31:35 Download gff for BO24730.complete
Subject Subject Range Query Range Percent Splice Strand
CG15577-RA 95..391 17..315 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:31:35 Download gff for BO24730.complete
Subject Subject Range Query Range Percent Splice Strand
X 4276608..4276906 17..315 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:22:12 Download gff for BO24730.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 4170641..4170939 17..315 99   Minus

BO24730.pep Sequence

Translation from 16 to 331

> BO24730.pep
MPVTYRTRTLPQQRKLVPNLLRSILRVLEETRRPMSDKELNFVLGVQYRR
NDPEFYRQVQVNLRDGVEYGILKRQGNQFSLRSRRLGELMSTLGSSPNRA
SFLDH

BO24730.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:41:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG15577-PA 99 CG15577-PA 1..99 1..99 502 100 Plus
CG15578-PA 89 CG15578-PA 7..78 9..81 254 68.5 Plus