Clone BO24734 Report

Search the DGRC for BO24734

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:247
Well:34
Vector:pDNR-Dual
Associated Gene/TranscriptTim13-RA
Protein status:BO24734.pep: Imported from assembly
Sequenced Size:310

Clone Sequence Records

BO24734.complete Sequence

310 bp assembled on 2010-05-17

GenBank Submission: KX799620

> BO24734.complete
GAAGTTATCAGTCGACATGGCGGCTGCCAACATGGAGAAGGGTGAGCTGA
TGAACCAGGTGAAACAACAGATCGCATTGGCCAATGCCCAGGAGATGCTC
TCGAAGATGACGGAGAAGTGCTTCAAGAAGTGCATCCAGAAGCCGGGAAA
ATCACTGGACTCCACCGAGCAGCGTTGCATTTCGCAGTGCATGGATCGCT
TCATGGACGCCTGGAATCTGGTGTCGCGCACCTATGGCAATCGTCTGCAG
CGTGAACAGTACAGGACCATGGAATCGTTGGAGATGACCAGCGCAAGCTT
TCTAGACCAT

BO24734.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:35:58
Subject Length Description Subject Range Query Range Score Percent Strand
Tim13-RA 279 CG11611-PA 1..276 17..292 1380 100 Plus
CG34132-RA 255 CG34132-PA 17..200 33..216 260 76.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:35:59
Subject Length Description Subject Range Query Range Score Percent Strand
Tim13-RA 442 CG11611-RA 86..365 13..292 1385 99.6 Plus
CG34132-RA 535 CG34132-RA 163..346 33..216 260 76.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:35:55
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11774137..11774416 292..13 1385 99.6 Minus
2L 23513712 2L 7885665..7885781 33..149 210 78.6 Plus
Blast to na_te.dros performed on 2014-11-28 02:35:57 has no hits.

BO24734.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-17 10:58:20 Download gff for BO24734.complete
Subject Subject Range Query Range Percent Splice Strand
Tim13-RA 1..276 17..294 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:23:07 Download gff for BO24734.complete
Subject Subject Range Query Range Percent Splice Strand
Tim13-RA 90..365 17..294 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:32:24 Download gff for BO24734.complete
Subject Subject Range Query Range Percent Splice Strand
Tim13-RA 90..365 17..294 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:32:24 Download gff for BO24734.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11774135..11774412 17..294 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:23:07 Download gff for BO24734.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11767235..11767512 17..294 99   Minus

BO24734.pep Sequence

Translation from 16 to 310

> BO24734.pep
MAAANMEKGELMNQVKQQIALANAQEMLSKMTEKCFKKCIQKPGKSLDST
EQRCISQCMDRFMDAWNLVSRTYGNRLQREQYRTMESLEMTSASFLDH

BO24734.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:43:59
Subject Length Description Subject Range Query Range Score Percent Strand
Tim13-PA 92 CG11611-PA 1..92 1..92 475 100 Plus
CG34132-PA 84 CG34132-PA 1..81 1..81 350 76.5 Plus
CG42302-PA 121 CG42302-PA 8..90 12..94 190 44.6 Plus