Clone BO24737 Report

Search the DGRC for BO24737

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:247
Well:37
Vector:pDNR-Dual
Associated Gene/TranscriptCG33977-RA
Protein status:BO24737.pep: Imported from assembly
Sequenced Size:316

Clone Sequence Records

BO24737.complete Sequence

316 bp assembled on 2010-05-17

GenBank Submission: KX795780

> BO24737.complete
GAAGTTATCAGTCGACATGACAAATCTACAACGCTGGCTATTTTACGCAT
CGCTCTTTGCGATTCCCTATCTCTCCGTTGTTTTGGGAACAGTGCAAACG
CCACTAACTACCAAGTATTTCCTGCACATTCAGCTTTTACCACTTTTGCT
CCTCGTGATTTTTGGAATATATTCCGTTTGGACTGTTCTATATAGAACTC
TGACTTTTAACGATTGTCCCGAGGCCGCCAAGGAGCTGCAGGATGAAATT
CAGGAGGCTCGCAAGGATTTGATAGCCAAGGGATTTCGGTTTCGAGATGC
AAGCTTTCTAGACCAT

BO24737.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:34:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG33977-RA 285 CG33977-PA 1..282 17..298 1410 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:34:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG33977-RA 425 CG33977-RA 64..345 17..298 1410 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:33:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13402839..13402988 166..17 750 100 Minus
3R 32079331 3R 13402639..13402770 298..167 660 100 Minus
Blast to na_te.dros performed on 2014-11-28 02:34:00 has no hits.

BO24737.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-17 10:58:09 Download gff for BO24737.complete
Subject Subject Range Query Range Percent Splice Strand
CG33977-RA 62..343 17..300 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:22:25 Download gff for BO24737.complete
Subject Subject Range Query Range Percent Splice Strand
CG33977-RA 42..323 17..300 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:31:47 Download gff for BO24737.complete
Subject Subject Range Query Range Percent Splice Strand
CG33977-RA 64..345 17..300 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:31:47 Download gff for BO24737.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13402637..13402770 167..300 98 <- Minus
3R 13402839..13402988 17..166 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:22:25 Download gff for BO24737.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9228359..9228492 167..300 98 <- Minus
arm_3R 9228561..9228710 17..166 100   Minus

BO24737.pep Sequence

Translation from 16 to 316

> BO24737.pep
MTNLQRWLFYASLFAIPYLSVVLGTVQTPLTTKYFLHIQLLPLLLLVIFG
IYSVWTVLYRTLTFNDCPEAAKELQDEIQEARKDLIAKGFRFRDASFLDH

BO24737.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:41:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG33977-PA 94 CG33977-PA 1..94 1..94 485 100 Plus