Clone BO24749 Report

Search the DGRC for BO24749

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:247
Well:49
Vector:pDNR-Dual
Associated Gene/TranscriptCcp84Af-RA
Protein status:BO24749.pep: Imported from assembly
Sequenced Size:487

Clone Sequence Records

BO24749.complete Sequence

487 bp assembled on 2010-05-17

GenBank Submission: KX795635

> BO24749.complete
GAAGTTATCAGTCGACATGGCCTTCAAGTTCTTCGCTGTTCTCGCCCTCA
TCTCGGCCGCCAGTGCCGGAGTTCTTCCCGTCCAGCAGGTGTATCACGCC
GCCCCCGCCGTGGCCACCTACGCCCAAGCACCTGTCGCCGTTGCCCACGC
CCAGCCGGTTCTGACCAAGGCCACCGAGGAATACGATCCCCATCCCCAGT
ACAAGTTCGCCTACGATGTCCAGGACTCCCTTTCCGGAGACTCGAAGAGT
CAGGTTGAGGAGCGTGATGGCGACGTGGTCCATGGCGAGTACTCCCTGAT
CGATTCCGATGGCTACAAGCGCATTGTCCAGTACACCTCCGACCCGGTCA
ACGGTTTCAACGCCGTCGTCAACCGCGTTCCCCTGGATCACGTGAAGACC
GTGGTGAAGACCGTGGCTCCTGTGGCCGTGGCTGCTGCCCCTATCCCAGT
GGCCTACCACCAGCACCACGCAAGCTTTCTAGACCAT

BO24749.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:36:48
Subject Length Description Subject Range Query Range Score Percent Strand
Ccp84Af-RA 456 CG1331-PA 1..453 17..469 2265 100 Plus
Ccp84Ad-RA 600 CG2341-PA 1..370 17..386 1205 88.4 Plus
Cpr5C-RA 438 CG4052-PA 138..410 148..426 595 81.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:36:49
Subject Length Description Subject Range Query Range Score Percent Strand
Ccp84Af-RA 580 CG1331-RA 53..506 16..469 2270 100 Plus
Ccp84Ad-RA 735 CG2341-RA 67..436 17..386 1205 88.4 Plus
Cpr5C-RA 605 CG4052-RA 192..464 148..426 595 81.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:36:45
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6689676..6690118 469..27 2215 100 Minus
3R 32079331 3R 6692884..6693228 42..386 1170 89.3 Plus
X 23542271 X 5804931..5805203 148..426 595 81.7 Plus
3R 32079331 3R 6704277..6704571 86..386 465 77.7 Plus
3R 32079331 3R 6702374..6702668 386..86 420 76.7 Minus
3R 32079331 3R 6687088..6687275 176..363 340 78.7 Plus
3R 32079331 3R 6691265..6691450 370..185 315 78 Minus
3R 32079331 3R 6695740..6695935 386..191 275 76 Minus
3L 28110227 3L 4215945..4216123 185..363 250 76 Plus
2L 23513712 2L 11945176..11945341 171..336 215 75.3 Plus
3L 28110227 3L 4211080..4211255 360..185 205 74.4 Minus
Blast to na_te.dros performed on 2014-11-28 02:36:47 has no hits.

BO24749.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-17 10:58:24 Download gff for BO24749.complete
Subject Subject Range Query Range Percent Splice Strand
Ccp84Af-RA 1..453 17..471 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:23:27 Download gff for BO24749.complete
Subject Subject Range Query Range Percent Splice Strand
Ccp84Af-RA 54..506 17..471 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:32:39 Download gff for BO24749.complete
Subject Subject Range Query Range Percent Splice Strand
Ccp84Af-RA 54..506 17..471 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:32:39 Download gff for BO24749.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6689673..6690122 21..471 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:23:27 Download gff for BO24749.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2515395..2515844 21..471 98   Minus

BO24749.pep Sequence

Translation from 16 to 487

> BO24749.pep
MAFKFFAVLALISAASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQPVLT
KATEEYDPHPQYKFAYDVQDSLSGDSKSQVEERDGDVVHGEYSLIDSDGY
KRIVQYTSDPVNGFNAVVNRVPLDHVKTVVKTVAPVAVAAAPIPVAYHQH
HASFLDH

BO24749.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:44:22
Subject Length Description Subject Range Query Range Score Percent Strand
Ccp84Af-PA 151 CG1331-PA 1..151 1..151 775 100 Plus
Ccp84Ad-PA 199 CG2341-PA 1..151 1..147 598 82.1 Plus
Cpr5C-PA 145 CG4052-PA 1..144 1..148 542 74.7 Plus
Ccp84Aa-PA 205 CG2360-PA 1..151 1..147 491 69.3 Plus
Ccp84Ab-PA 221 CG1252-PA 1..151 1..147 486 68.6 Plus