Clone BO24752 Report

Search the DGRC for BO24752

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:247
Well:52
Vector:pDNR-Dual
Associated Gene/TranscriptCecA1-RA
Protein status:BO24752.pep: Inserted from web
Sequenced Size:223

Clone Sequence Records

BO24752.complete Sequence

223 bp assembled on 2010-05-17

GenBank Submission: KX797894

> BO24752.complete
GAAGTTATCAGTCGACATGAACTTCTACAACATCTTCGTTTTCGTCGCTC
TCATTCTGGCCATCACCATTGGACAATCGGAAGCTGGTTGGCTAAAGAAA
ATTGGCAAGAAAATCGAACGTGTTGGTCAGCACACTCGCGACGCCACAAT
CCAGGGACTGGGAATCGCTCAACAGGCCGCCAATGTTGCAGCCACTGCTC
GAGGTGCAAGCTTTCTAGACCAT

BO24752.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:38:09
Subject Length Description Subject Range Query Range Score Percent Strand
CecA2-RA 192 CG1367-PA 1..189 17..205 945 100 Plus
CecA1-RA 192 CG1365-PA 1..189 17..205 795 94.7 Plus
CecC-RA 192 CG1373-PA 1..179 17..195 565 87.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:38:10
Subject Length Description Subject Range Query Range Score Percent Strand
CecA2-RA 355 CG1367-RA 82..271 16..205 950 100 Plus
CecA1-RA 339 CG1365-RA 74..263 16..205 800 94.7 Plus
CecC-RA 386 CG1373-RA 93..272 16..195 570 87.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:38:06
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30212237..30212337 16..116 505 100 Plus
3R 32079331 3R 30210947..30211047 16..116 475 98 Plus
3R 32079331 3R 30212395..30212484 116..205 450 100 Plus
3R 32079331 3R 30216576..30216676 16..116 385 92.1 Plus
3R 32079331 3R 30211108..30211197 116..205 330 91.1 Plus
3R 32079331 3R 30213479..30213568 205..116 255 85.6 Minus
3R 32079331 3R 30216752..30216824 123..195 200 84.9 Plus
3R 32079331 3R 30213626..30213730 116..12 195 79 Minus
Blast to na_te.dros performed on 2014-11-28 02:38:07 has no hits.

BO24752.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-09 16:56:52 Download gff for BO24752.complete
Subject Subject Range Query Range Percent Splice Strand
CecA2-RA 83..271 17..207 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:23:58 Download gff for BO24752.complete
Subject Subject Range Query Range Percent Splice Strand
CecA2-RA 83..271 17..207 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:33:07 Download gff for BO24752.complete
Subject Subject Range Query Range Percent Splice Strand
CecA2-RA 83..271 17..207 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:33:07 Download gff for BO24752.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30212238..30212336 17..115 100 -> Plus
3R 30212395..30212484 116..207 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:23:58 Download gff for BO24752.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26037960..26038058 17..115 100 -> Plus
arm_3R 26038117..26038206 116..207 97   Plus

BO24752.pep Sequence

Translation from 16 to 223

> BO24752.pep
MNFYNIFVFVALILAITIGQSEAGWLKKIGKKIERVGQHTRDATIQGLGI
AQQAANVAATARGASFLDH

BO24752.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:44:51
Subject Length Description Subject Range Query Range Score Percent Strand
CecA2-PA 63 CG1367-PA 1..63 1..63 313 100 Plus
CecA1-PA 63 CG1365-PA 1..63 1..63 313 100 Plus
CecC-PA 63 CG1373-PA 1..63 1..63 297 92.1 Plus
CecB-PA 63 CG1878-PA 1..63 1..63 268 84.1 Plus