Clone BO24775 Report

Search the DGRC for BO24775

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:247
Well:75
Vector:pDNR-Dual
Associated Gene/TranscriptCG3713-RA
Protein status:BO24775.pep: Imported from assembly
Sequenced Size:283

Clone Sequence Records

BO24775.complete Sequence

283 bp assembled on 2010-05-17

GenBank Submission: KX794073

> BO24775.complete
GAAGTTATCAGTCGACATGTTTCTGGGCTTCTTGGTGGATCTGCTGTACT
GCCGACGCTGCGGGGACGACTGTATGATGGAATTCCCATCGACTTCCGCG
AATGAAGAAGCAGCGCCGAAAGTGGTAAAGGTCGAACTGCCGCCGCTGCC
GCCACTGACCTTTGAACTCATCCGCAATCCATTGGCTGCCGACCAGGAGT
GCGATGATAGCTTCGAAGGCTTCGTCGATGGTTATGATGATCCCAGGCTG
CCGGAAACCATCATCGCAAGCTTTCTAGACCAT

BO24775.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:32:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG3713-RB 252 CG3713-PB 1..249 17..265 1245 100 Plus
CG3713-RA 252 CG3713-PA 1..249 17..265 1245 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:32:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG3713-RB 500 CG3713-RB 55..303 17..265 1245 100 Plus
CG3713-RA 987 CG3713-RA 55..303 17..265 1245 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:32:34
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 846855..847103 265..17 1245 100 Minus
Blast to na_te.dros performed on 2014-11-28 02:32:35 has no hits.

BO24775.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-17 10:58:01 Download gff for BO24775.complete
Subject Subject Range Query Range Percent Splice Strand
CG3713-RA 72..314 23..267 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:21:52 Download gff for BO24775.complete
Subject Subject Range Query Range Percent Splice Strand
CG3713-RA 61..303 23..267 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:31:20 Download gff for BO24775.complete
Subject Subject Range Query Range Percent Splice Strand
CG3713-RA 61..303 23..267 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:31:20 Download gff for BO24775.complete
Subject Subject Range Query Range Percent Splice Strand
X 846852..847097 23..267 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:21:52 Download gff for BO24775.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 740885..741130 23..267 99   Minus

BO24775.pep Sequence

Translation from 16 to 283

> BO24775.pep
MFLGFLVDLLYCRRCGDDCMMEFPSTSANEEAAPKVVKVELPPLPPLTFE
LIRNPLAADQECDDSFEGFVDGYDDPRLPETIIASFLDH

BO24775.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:41:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG3713-PB 83 CG3713-PB 1..83 1..83 448 100 Plus
CG3713-PA 83 CG3713-PA 1..83 1..83 448 100 Plus