BO24775.complete Sequence
283 bp assembled on 2010-05-17
GenBank Submission: KX794073
> BO24775.complete
GAAGTTATCAGTCGACATGTTTCTGGGCTTCTTGGTGGATCTGCTGTACT
GCCGACGCTGCGGGGACGACTGTATGATGGAATTCCCATCGACTTCCGCG
AATGAAGAAGCAGCGCCGAAAGTGGTAAAGGTCGAACTGCCGCCGCTGCC
GCCACTGACCTTTGAACTCATCCGCAATCCATTGGCTGCCGACCAGGAGT
GCGATGATAGCTTCGAAGGCTTCGTCGATGGTTATGATGATCCCAGGCTG
CCGGAAACCATCATCGCAAGCTTTCTAGACCAT
BO24775.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:32:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG3713-RB | 252 | CG3713-PB | 1..249 | 17..265 | 1245 | 100 | Plus |
CG3713-RA | 252 | CG3713-PA | 1..249 | 17..265 | 1245 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:32:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG3713-RB | 500 | CG3713-RB | 55..303 | 17..265 | 1245 | 100 | Plus |
CG3713-RA | 987 | CG3713-RA | 55..303 | 17..265 | 1245 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:32:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 846855..847103 | 265..17 | 1245 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 02:32:35 has no hits.
BO24775.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-17 10:58:01 Download gff for
BO24775.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3713-RA | 72..314 | 23..267 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:21:52 Download gff for
BO24775.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3713-RA | 61..303 | 23..267 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:31:20 Download gff for
BO24775.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3713-RA | 61..303 | 23..267 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:31:20 Download gff for
BO24775.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 846852..847097 | 23..267 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:21:52 Download gff for
BO24775.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 740885..741130 | 23..267 | 99 | | Minus |
BO24775.pep Sequence
Translation from 16 to 283
> BO24775.pep
MFLGFLVDLLYCRRCGDDCMMEFPSTSANEEAAPKVVKVELPPLPPLTFE
LIRNPLAADQECDDSFEGFVDGYDDPRLPETIIASFLDH
BO24775.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:41:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG3713-PB | 83 | CG3713-PB | 1..83 | 1..83 | 448 | 100 | Plus |
CG3713-PA | 83 | CG3713-PA | 1..83 | 1..83 | 448 | 100 | Plus |