Clone BO24828 Report

Search the DGRC for BO24828

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:248
Well:28
Vector:pDNR-Dual
Associated Gene/TranscriptCG14096-RA
Protein status:BO24828.pep: Imported from assembly
Sequenced Size:400

Clone Sequence Records

BO24828.complete Sequence

400 bp assembled on 2010-05-17

GenBank Submission: KX795219

> BO24828.complete
GAAGTTATCAGTCGACATGTTCAAATCCGCCGTTGTTATTCTGGCTATCG
TTGCCTGCGCTGCTGCCAAGCCTGGACTTCTGGGTGCTCCCCTTGCTTAC
ACTGCTCCTCTGGCTTACTCTGCTCCTCTGGCTTACTCAGCTCCTGCTGC
CGTGGTAGCTGCTCCCGCTCCAGTTGTGACCGCCACCAGTAGCCAGGTTA
TCGCCAGGAACTACAATGGAATCGCCGTTGCTCCTGTGATTGCTCCCGTT
GCCGCTCCTGTGGTGGCCAAGTACACTGCTGCTCCTTTTGCCTACGCTTC
TCCTTTGGCCTACTCCGCTCCTCTGGCTTACACTTCTCCATTGGCTTATA
AAACTCTTCCGGCTGCTGCTCCAGTTCTTCTGGCAAGCTTTCTAGACCAT

BO24828.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:35:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG14096-RA 369 CG14096-PA 1..366 17..382 1830 100 Plus
CG18294-RA 426 CG18294-PA 1..276 17..292 1320 98.6 Plus
CG12519-RB 396 CG12519-PB 1..269 17..285 1315 99.3 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:35:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG14096-RA 458 CG14096-RA 51..416 17..382 1830 100 Plus
CG18294-RA 507 CG18294-RA 55..330 17..292 1320 98.6 Plus
CG12519-RB 600 CG12519-RB 53..321 17..285 1315 99.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:35:43
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 19466609..19466962 382..29 1770 100 Minus
3L 28110227 3L 19475194..19475457 292..29 1260 98.5 Minus
3L 28110227 3L 19472610..19472866 29..285 1255 99.2 Plus
3L 28110227 3L 19478373..19478568 49..244 725 91.3 Plus
3L 28110227 3L 19423849..19424044 49..244 710 90.8 Plus
3L 28110227 3L 19467481..19467687 39..263 685 88 Plus
3L 28110227 3L 19471890..19472096 263..39 685 88 Minus
3L 28110227 3L 19475971..19476177 39..263 685 88 Plus
3L 28110227 3L 19488045..19488308 49..321 670 83.9 Plus
3L 28110227 3L 19423125..19423224 246..147 335 89 Minus
3L 28110227 3L 19424757..19424836 159..238 295 91.2 Plus
3L 28110227 3L 19424852..19424908 296..352 240 94.7 Plus
3L 28110227 3L 19464433..19464518 243..158 205 82.6 Minus
3L 28110227 3L 19424828..19424887 254..313 180 86.7 Plus
Blast to na_te.dros performed 2014-11-28 02:35:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2777..2849 177..102 147 69.7 Minus

BO24828.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-17 10:58:19 Download gff for BO24828.complete
Subject Subject Range Query Range Percent Splice Strand
CG14096-RA 56..416 22..384 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:23:03 Download gff for BO24828.complete
Subject Subject Range Query Range Percent Splice Strand
CG14096-RA 56..416 22..384 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:32:21 Download gff for BO24828.complete
Subject Subject Range Query Range Percent Splice Strand
CG14096-RA 56..416 22..384 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:32:21 Download gff for BO24828.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19466607..19466962 29..384 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:23:03 Download gff for BO24828.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19459707..19460062 29..384 99   Minus

BO24828.pep Sequence

Translation from 16 to 400

> BO24828.pep
MFKSAVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP
APVVTATSSQVIARNYNGIAVAPVIAPVAAPVVAKYTAAPFAYASPLAYS
APLAYTSPLAYKTLPAAAPVLLASFLDH

BO24828.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:43:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG14096-PA 122 CG14096-PA 1..122 1..122 595 100 Plus
CG12519-PB 131 CG12519-PB 1..131 1..122 486 78.9 Plus
CG12519-PA 131 CG12519-PA 1..131 1..122 486 78.9 Plus
CG18294-PA 141 CG18294-PA 1..141 1..122 486 76.8 Plus
CG32214-PC 116 CG32214-PC 1..116 1..122 418 74.6 Plus