Clone BO24836 Report

Search the DGRC for BO24836

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:248
Well:36
Vector:pDNR-Dual
Associated Gene/TranscriptCG34026-RA
Protein status:BO24836.pep: Imported from assembly
Sequenced Size:385

Clone Sequence Records

BO24836.complete Sequence

385 bp assembled on 2010-05-17

GenBank Submission: KX796900

> BO24836.complete
GAAGTTATCAGTCGACATGAAATATCCCACAATTATTTTATTTGCGCTAG
CCGCATTCATTTTGCCAACATTTGCCGCAAATGACTACCTGTGGGGTGAA
GTTGGTGCAGATGATTACCAATTGGCAAAGGATACGGTTTCGAAGGCGTT
TTTCGTTGGTCTAGTGCAGACGAAAAAATACGTATTCAAGCAGTCGGACA
ACCTAAATGCGTTGACCATTACGGCAATTAAGATTACCGACAAAAAGAAG
AGTCACGGAGCAACTGCTGTATTGGTCAGTGGAGGTCCTGGATCCAAAGG
AGCAACTATTAAGTTCACTTCCGAACGAGGTTACGGCATCAAGGATATCG
TGGAAATATGGGGTCGTGCAAGCTTTCTAGACCAT

BO24836.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:36:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG34026-RB 354 CG34026-PB 1..351 17..367 1755 100 Plus
CG34026-RA 354 CG34026-PA 1..351 17..367 1755 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:36:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG34026-RB 747 CG34026-RB 27..377 17..367 1755 100 Plus
CG34026-RA 427 CG34026-RA 27..377 17..367 1755 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:36:06
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 9533844..9534024 17..197 905 100 Plus
X 23542271 X 9534084..9534255 196..367 860 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:36:08 has no hits.

BO24836.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-17 10:58:20 Download gff for BO24836.complete
Subject Subject Range Query Range Percent Splice Strand
CG34026-RA 1..351 17..369 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:23:11 Download gff for BO24836.complete
Subject Subject Range Query Range Percent Splice Strand
CG34026-RA 27..377 17..369 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:32:26 Download gff for BO24836.complete
Subject Subject Range Query Range Percent Splice Strand
CG34026-RA 27..377 17..369 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:32:26 Download gff for BO24836.complete
Subject Subject Range Query Range Percent Splice Strand
X 9533844..9534023 17..196 100 -> Plus
X 9534085..9534255 197..369 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:23:11 Download gff for BO24836.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 9427877..9428056 17..196 100 -> Plus
arm_X 9428118..9428288 197..369 98   Plus

BO24836.pep Sequence

Translation from 16 to 385

> BO24836.pep
MKYPTIILFALAAFILPTFAANDYLWGEVGADDYQLAKDTVSKAFFVGLV
QTKKYVFKQSDNLNALTITAIKITDKKKSHGATAVLVSGGPGSKGATIKF
TSERGYGIKDIVEIWGRASFLDH

BO24836.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:44:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG34026-PB 117 CG34026-PB 1..117 1..117 598 100 Plus
CG34026-PA 117 CG34026-PA 1..117 1..117 598 100 Plus
CG30413-PA 122 CG30413-PA 28..120 22..116 192 48.4 Plus