BO24847.complete Sequence
247 bp assembled on 2010-05-17
GenBank Submission: KX799752
> BO24847.complete
GAAGTTATCAGTCGACATGGTGCAGATGATATTCCTGTTTGCTATCCTTG
CTGTAATGACCATTGTCCTAATGGAGGCCAACACTGTTTTGGCACGTGAT
TGCCTATCTGGAACTTTCGGAGGTCCTTGCTGGGCCTGGAGTGGAGAAAA
GTGCCGCCGTCTCTGCATTGAGGAGGGACATGTCAGTGGACACTGCAGTG
GCGCAATGAAGTGCTGGTGCGAAGGATGCGCAAGCTTTCTAGACCAT
BO24847.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:30:08
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Drsl3-RA | 216 | CG32283-PA | 1..213 | 17..229 | 1065 | 100 | Plus |
| Drsl4-RA | 216 | CG32282-PA | 20..207 | 36..223 | 445 | 82.4 | Plus |
| Drsl2-RA | 213 | CG32279-PA | 132..210 | 151..229 | 200 | 83.5 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:30:09
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Drsl3-RA | 360 | CG32283-RA | 29..251 | 7..229 | 1085 | 99.1 | Plus |
| Drsl4-RA | 323 | CG32282-RA | 37..224 | 36..223 | 445 | 82.4 | Plus |
| Drsl2-RA | 333 | CG32279-RA | 158..236 | 151..229 | 200 | 83.5 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:30:05
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3L | 28110227 | 3L | 3315024..3315246 | 7..229 | 1085 | 99.1 | Plus |
| 3L | 28110227 | 3L | 3315656..3315843 | 36..223 | 445 | 82.4 | Plus |
| 3L | 28110227 | 3L | 3314506..3314584 | 151..229 | 200 | 83.5 | Plus |
Blast to na_te.dros performed on 2014-11-28 02:30:06 has no hits.
BO24847.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-17 10:57:48 Download gff for
BO24847.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| dro3-RA | 39..251 | 17..231 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:20:59 Download gff for
BO24847.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Drsl3-RA | 39..251 | 17..231 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:30:34 Download gff for
BO24847.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Drsl3-RA | 39..251 | 17..231 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:30:34 Download gff for
BO24847.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3L | 3315034..3315246 | 17..231 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:20:59 Download gff for
BO24847.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3L | 3315034..3315246 | 17..231 | 99 | | Plus |
BO24847.pep Sequence
Translation from 16 to 247
> BO24847.pep
MVQMIFLFAILAVMTIVLMEANTVLARDCLSGTFGGPCWAWSGEKCRRLC
IEEGHVSGHCSGAMKCWCEGCASFLDH
BO24847.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:40:32
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Drsl3-PA | 71 | CG32283-PA | 1..71 | 1..71 | 401 | 100 | Plus |
| Drsl4-PA | 71 | CG32282-PA | 1..71 | 1..71 | 280 | 69 | Plus |
| Drsl2-PA | 70 | CG32279-PA | 1..70 | 1..71 | 260 | 64.8 | Plus |
| Drsl5-PA | 69 | CG10812-PA | 1..69 | 2..71 | 231 | 58.6 | Plus |
| Drs-PA | 70 | CG10810-PA | 1..70 | 1..71 | 230 | 56.3 | Plus |
