Clone BO24862 Report

Search the DGRC for BO24862

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:248
Well:62
Vector:pDNR-Dual
Associated Gene/Transcriptlectin-37Db-RA
Protein status:BO24862.pep: Imported from assembly
Sequenced Size:484

Clone Sequence Records

BO24862.complete Sequence

484 bp assembled on 2010-05-17

GenBank Submission: KX795191

> BO24862.complete
GAAGTTATCAGTCGACATGATGGTCAAACTTCTCCTGCTGTTCCTGGTAT
GCTGGAGTGCTCTTCCTTTGGAGTCATCTCCCTTGGGTAACCGATATAAC
CTAGAGATCGGTGAAAAGCAGTACTACATTTCGTTGGCAAAGACCAACTG
GTTCGAGGCAAGCAACCACTGTCGTCAGAATGGCGGATTTCTTCTCAATT
TGGAGAGCAGAGAGGAACTGGAGCTCCTTAGCCCCCACCTTCACCCAGCC
TACAGCTATTGGCTATCCATCAATGACCTCGGCGAACGGGGCGTATACGT
GTCGGAGGCCACTGGTCTAGAGGCTCCGTTTCTTAACTGGTCCGCCGGAG
AGCCGGACAACAGCAGTGGCTACGATCGATGTGTCGAGCTGTGGTTGTCG
ACAACCTCCTTCCAGATGAACGACCTCCCATGCTATAGCTCCGTCGCCTT
CATTTGCCAGCTTAACGCAAGCTTTCTAGACCAT

BO24862.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:30:35
Subject Length Description Subject Range Query Range Score Percent Strand
lectin-37Db-RB 453 CG33533-PB 1..450 17..466 2250 100 Plus
lectin-37Db-RA 453 CG33533-PA 1..450 17..466 2250 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:30:36
Subject Length Description Subject Range Query Range Score Percent Strand
lectin-37Db-RB 548 CG33533-RB 23..472 17..466 2250 100 Plus
lectin-37Db-RA 562 CG33533-RA 23..472 17..466 2250 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:30:32
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19419307..19419677 96..466 1855 100 Plus
2L 23513712 2L 19419097..19419179 17..99 400 98.8 Plus
Blast to na_te.dros performed on 2014-11-28 02:30:34 has no hits.

BO24862.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-17 10:57:51 Download gff for BO24862.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-37Db-RA 1..450 17..468 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:21:09 Download gff for BO24862.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-37Db-RA 23..472 17..468 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:30:44 Download gff for BO24862.complete
Subject Subject Range Query Range Percent Splice Strand
lectin-37Db-RA 23..472 17..468 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:30:44 Download gff for BO24862.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19419097..19419175 17..95 100 -> Plus
2L 19419307..19419677 96..468 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:21:09 Download gff for BO24862.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19419097..19419175 17..95 100 -> Plus
arm_2L 19419307..19419677 96..468 99   Plus

BO24862.pep Sequence

Translation from 16 to 484

> BO24862.pep
MMVKLLLLFLVCWSALPLESSPLGNRYNLEIGEKQYYISLAKTNWFEASN
HCRQNGGFLLNLESREELELLSPHLHPAYSYWLSINDLGERGVYVSEATG
LEAPFLNWSAGEPDNSSGYDRCVELWLSTTSFQMNDLPCYSSVAFICQLN
ASFLDH

BO24862.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:40:37
Subject Length Description Subject Range Query Range Score Percent Strand
lectin-37Db-PB 150 CG33533-PB 1..150 1..150 809 100 Plus
lectin-37Db-PA 150 CG33533-PA 1..150 1..150 809 100 Plus
lectin-24Db-PA 359 CG2958-PA 241..354 31..148 227 42 Plus
CG9134-PC 188 CG9134-PC 55..185 29..149 218 35.1 Plus
CG9134-PA 188 CG9134-PA 55..185 29..149 218 35.1 Plus