Clone BO24934 Report

Search the DGRC for BO24934

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:249
Well:34
Vector:pDNR-Dual
Associated Gene/TranscriptYippee-RB
Protein status:BO24934.pep: Imported from assembly
Sequenced Size:364

Clone Sequence Records

BO24934.complete Sequence

364 bp assembled on 2010-06-03

GenBank Submission: KX799511

> BO24934.complete
GAAGTTATCAGTCGACATGGGACGCATTTTCTTGGAACATCTTGGGGGTC
TGAAACTCTTCAATTGCGCCCAATGCCACACGAACCTGACCAACCGCAGT
CAATTGATCAGTACCCGATTCACAGGCGCAACAGGACGCGCCTATCTGTT
TAAGCGTGTGGTCAACCTGACCTTCAGCAACATCCAGGAACGGGTCATGC
TCACGGGTCGCCACATGGTGCGCGACGTTATGTGCAAGAATTGTGGAGCC
AAACTTGGCTGGATGTACGAGTTCGCCACCGAAGAGTCACAAAAGTGGGT
AAACGCGGATAGGCAGCTTGTCACTAGGGATTCTGGGTTATACAAGGCAA
GCTTTCTAGACCAT

BO24934.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:46:38
Subject Length Description Subject Range Query Range Score Percent Strand
Yippee-RB 333 CG1989-PB 1..330 17..346 1650 100 Plus
Yippee-RA 366 CG1989-PA 1..278 17..294 1390 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:46:39
Subject Length Description Subject Range Query Range Score Percent Strand
Yippee-RB 1293 CG1989-RB 341..670 17..346 1650 100 Plus
Yippee-RA 1136 CG1989-RA 341..618 17..294 1390 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:46:36
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 13386537..13386752 346..131 1080 100 Minus
X 23542271 X 13386814..13386932 135..17 595 100 Minus
Blast to na_te.dros performed on 2014-11-28 04:46:37 has no hits.

BO24934.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-03 13:59:25 Download gff for BO24934.complete
Subject Subject Range Query Range Percent Splice Strand
Yippee-RB 318..647 17..348 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:08:53 Download gff for BO24934.complete
Subject Subject Range Query Range Percent Splice Strand
Yippee-RB 318..647 17..348 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:57:00 Download gff for BO24934.complete
Subject Subject Range Query Range Percent Splice Strand
Yippee-RB 341..670 17..348 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:57:00 Download gff for BO24934.complete
Subject Subject Range Query Range Percent Splice Strand
X 13386535..13386748 135..348 99 <- Minus
X 13386815..13386932 17..134 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:08:53 Download gff for BO24934.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 13280568..13280781 135..348 99 <- Minus
arm_X 13280848..13280965 17..134 100   Minus

BO24934.pep Sequence

Translation from 16 to 364

> BO24934.pep
MGRIFLEHLGGLKLFNCAQCHTNLTNRSQLISTRFTGATGRAYLFKRVVN
LTFSNIQERVMLTGRHMVRDVMCKNCGAKLGWMYEFATEESQKWVNADRQ
LVTRDSGLYKASFLDH

BO24934.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:41:33
Subject Length Description Subject Range Query Range Score Percent Strand
Yippee-PB 110 CG1989-PB 1..110 1..110 585 100 Plus
Yippee-PA 121 CG1989-PA 1..94 1..94 496 98.9 Plus
CG15309-PE 114 CG15309-PE 14..95 13..94 204 45.1 Plus
CG15309-PD 114 CG15309-PD 14..95 13..94 204 45.1 Plus
CG15309-PC 114 CG15309-PC 14..95 13..94 204 45.1 Plus