Clone BO24946 Report

Search the DGRC for BO24946

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:249
Well:46
Vector:pDNR-Dual
Associated Gene/TranscriptCG34159-RA
Protein status:BO24946.pep: Imported from assembly
Sequenced Size:475

Clone Sequence Records

BO24946.complete Sequence

475 bp assembled on 2010-06-03

GenBank Submission: KX799815

> BO24946.complete
GAAGTTATCAGTCGACATGGATCGCAATAATGGACGCTATCCCTACAACA
TTAGGCGGCAGAACAGCGGGCACAATGCGCCGCACAGCTACCATCACCAC
CATAACAACAATTCGGCGGCGGGGGCGTCCAATTCGCCGGGATACAATAA
CCACAGTGCCGGAAACTCTCCGTCCGTCGGTGGCCATAACAACAGCAATC
CGCTCTACGCCTCCGCCGCCGGACAGCAGCAGCAACAACAGCAACCACAG
AGCCTGCCAATCTCGCAGCACGATGAGCTCATCCGGTACATCCGGGGGGC
ATGGATCAAGGTCTACGAACAGGGTCCACCTGTGCTGTACTGCAACGAAT
CCGACAATCAGCTGAAGAACTTTAAGCCATTCGATTTGGAGGAGTACTGG
GGCCAGCGCCTGGTGCAGAACATCCATGTGACCACCACGCAGGCCGGTGG
ACACCAGGCAAGCTTTCTAGACCAT

BO24946.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:50:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG34159-RA 444 CG34159-PA 1..441 17..457 2205 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:50:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG34159-RA 936 CG34159-RA 128..570 15..457 2215 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:50:10
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10203382..10203661 312..33 1400 100 Minus
2L 23513712 2L 10202886..10203034 457..309 745 100 Minus
Blast to na_te.dros performed 2014-11-27 00:50:11
Subject Length Description Subject Range Query Range Score Percent Strand
roo 9092 roo DM_ROO 9092bp 1050..1138 161..250 131 64.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2318..2537 42..259 127 57.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1557..1594 224..260 124 84.2 Plus
roo 9092 roo DM_ROO 9092bp 1053..1121 209..278 122 65.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2336..2402 183..250 120 69.6 Plus
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 3257..3319 183..249 119 69.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2309..2364 223..278 118 67.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2596..2659 188..249 117 67.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2408..2444 223..259 113 78.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6796..6823 223..250 113 89.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2312..2483 79..250 112 54.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6840..6907 188..250 111 69.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2303..2348 206..250 110 73.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2803..2851 222..270 110 69.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6829..6884 223..278 109 66.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2385..2411 224..250 108 88.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2802..2876 184..256 108 64 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6391..6571 76..259 107 58 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6733..6791 223..278 107 69.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6754..6812 223..278 107 69.5 Plus
roo 9092 roo DM_ROO 9092bp 1135..1162 223..250 104 85.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1505..1541 214..250 104 75.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 5654..5690 223..259 104 75.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6775..6802 223..250 104 85.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6866..6923 187..242 104 71.2 Plus

BO24946.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-03 13:59:41 Download gff for BO24946.complete
Subject Subject Range Query Range Percent Splice Strand
CG34159-RA 97..537 17..459 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:35:43 Download gff for BO24946.complete
Subject Subject Range Query Range Percent Splice Strand
CG34159-RA 130..570 17..459 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:11:03 Download gff for BO24946.complete
Subject Subject Range Query Range Percent Splice Strand
CG34159-RA 130..570 17..459 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:11:03 Download gff for BO24946.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10202884..10203032 311..459 98 <- Minus
2L 10203384..10203660 34..310 100 <- Minus
2L 10204172..10204188 17..33 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:35:43 Download gff for BO24946.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10202884..10203032 311..459 98 <- Minus
arm_2L 10203384..10203660 34..310 100 <- Minus
arm_2L 10204172..10204188 17..33 100   Minus

BO24946.pep Sequence

Translation from 16 to 475

> BO24946.pep
MDRNNGRYPYNIRRQNSGHNAPHSYHHHHNNNSAAGASNSPGYNNHSAGN
SPSVGGHNNSNPLYASAAGQQQQQQQPQSLPISQHDELIRYIRGAWIKVY
EQGPPVLYCNESDNQLKNFKPFDLEEYWGQRLVQNIHVTTTQAGGHQASF
LDH

BO24946.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:40:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG34159-PA 147 CG34159-PA 1..147 1..147 819 100 Plus