Clone BO24958 Report

Search the DGRC for BO24958

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:249
Well:58
Vector:pDNR-Dual
Associated Gene/TranscriptLcp65Ag1-RA
Protein status:BO24958.pep: Imported from assembly
Sequenced Size:349

Clone Sequence Records

BO24958.complete Sequence

349 bp assembled on 2010-06-03

GenBank Submission: KX798659

> BO24958.complete
GAAGTTATCAGTCGACATGAAATTCCTGATTGTCTTCGTCGCCCTCTTCG
CCGTGGCTCTGGCTGCTCCTGCCGCTGAGGAACCCACAATCGTGCGCTCT
GAATCCGACGTTGGACCCGAAAGCTTCAAATACGACTGGGAAACCTCCGA
TGGACAGGCTGCTCAAGCTGTAGGTCAGCTGAACGACATTGGAACTGAGA
ACGAGGCTATCTCTGTGAGTGGATCCTACCGCTTCATTGCTGATGATGGC
CAGACCTACCAAGTCAACTACATCGCCGATAAGAACGGATTCCAGCCCCA
GGGTGCTCATCTGCCCGTTGCCCCCGTGGCAGCAAGCTTTCTAGACCAT

BO24958.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:50:27
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp65Ag1-RA 318 CG10530-PA 1..315 17..331 1575 100 Plus
Lcp65Ag2-RA 318 CG10534-PA 1..314 17..330 1570 100 Plus
Lcp65Ag3-RA 318 CG18779-PA 1..315 17..331 1560 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:50:28
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp65Ag1-RA 517 CG10530-RA 61..376 16..331 1580 100 Plus
Lcp65Ag2-RA 543 CG10534-RA 61..375 16..330 1575 100 Plus
Lcp65Ag3-RA 543 CG18779-RA 60..375 16..331 1565 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:50:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6134838..6135033 331..136 980 100 Minus
3L 28110227 3L 6133158..6133352 330..136 975 100 Minus
3L 28110227 3L 6130554..6130749 331..136 965 99.5 Minus
3L 28110227 3L 6130811..6130930 135..16 600 100 Minus
3L 28110227 3L 6133414..6133533 135..16 600 100 Minus
3L 28110227 3L 6135095..6135214 135..16 600 100 Minus
3L 28110227 3L 6137725..6137826 322..221 405 93.1 Minus
3L 28110227 3L 6147570..6147653 327..244 315 91.7 Minus
3L 28110227 3L 6150441..6150524 327..244 315 91.7 Minus
3L 28110227 3L 6145194..6145289 221..316 285 86.5 Plus
3L 28110227 3L 6136385..6136555 329..159 270 77.2 Minus
3L 28110227 3L 6136699..6136742 58..15 190 95.5 Minus
3L 28110227 3L 6139425..6139496 316..245 180 83.3 Minus
Blast to na_te.dros performed on 2014-11-28 04:50:26 has no hits.

BO24958.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-03 13:59:50 Download gff for BO24958.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp65Ag1-RA 58..372 17..333 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:09:18 Download gff for BO24958.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp65Ag1-RA 62..376 17..333 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:58:42 Download gff for BO24958.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp65Ag1-RA 62..376 17..333 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:58:42 Download gff for BO24958.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6134836..6135033 136..333 98 <- Minus
3L 6135095..6135213 17..135 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:09:18 Download gff for BO24958.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6127936..6128133 136..333 98 <- Minus
arm_3L 6128195..6128313 17..135 100   Minus

BO24958.pep Sequence

Translation from 16 to 349

> BO24958.pep
MKFLIVFVALFAVALAAPAAEEPTIVRSESDVGPESFKYDWETSDGQAAQ
AVGQLNDIGTENEAISVSGSYRFIADDGQTYQVNYIADKNGFQPQGAHLP
VAPVAASFLDH

BO24958.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:40:51
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp65Ag1-PA 105 CG10530-PA 1..105 1..105 535 100 Plus
Lcp65Ag2-PA 105 CG10534-PA 1..105 1..105 535 100 Plus
Lcp65Ag3-PA 105 CG18779-PA 1..105 1..105 532 99 Plus
Lcp65Af-PA 100 CG10533-PA 1..99 1..104 351 64.4 Plus
Lcp65Ae-PA 99 CG10529-PA 1..98 1..102 349 67.6 Plus