BO24986.complete Sequence
448 bp assembled on 2010-06-03
GenBank Submission: KX799461
> BO24986.complete
GAAGTTATCAGTCGACATGAAGTACTTCGTTGCCATCGCTCTGCTGTTCG
CCGCCGCTCAGGCTGTTCCCATCGAGCTGGGCCACTACGCCCCTGCGCTG
GTGCATCATGCGCCAGTCCTGTCGCACGCCGTCCATGCCGTCCACGCCGA
GCCGGTGGCCTATCCCAAGTACTCCTTCAACTACGGCATTAAGGATCCCC
ACACCGGCGACATCAAGTCGCAGGCCGAGGAGCGCGACGGCGATGTGGTG
AAGGGCCAGTACTCCCTGGTTGAGCCCGATGGTTCGGTGCGCACCGTTGA
CTACACCGCCGACGACCACAATGGCTTCAATGCCGTCGTCCACAAGACCG
CCCCCAGTAAGATCATCGCCCATGCACCCGTGCTGCATGCCGCCCCCGTT
TTGGCCCACGCCCCCCTTCTGCATCACTACGCAAGCTTTCTAGACCAT
BO24986.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:48:08
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG34461-RB | 417 | CG34461-PB | 1..414 | 17..430 | 2070 | 100 | Plus |
| CG34461-RA | 417 | CG34461-PA | 1..414 | 17..430 | 2070 | 100 | Plus |
| Cpr62Bc-RB | 543 | CG1919-PB | 148..346 | 158..356 | 455 | 81.9 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:48:10
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG34461-RB | 1873 | CG34461-RB | 165..578 | 17..430 | 2070 | 100 | Plus |
| CG34461-RA | 681 | CG34461-RA | 165..578 | 17..430 | 2070 | 100 | Plus |
| Cpr62Bc-RB | 1017 | CG1919-RB | 228..426 | 158..356 | 455 | 81.9 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:48:05
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3L | 28110227 | 3L | 8326146..8326380 | 21..255 | 1175 | 100 | Plus |
| 3L | 28110227 | 3L | 8326836..8327012 | 254..430 | 885 | 100 | Plus |
| 3L | 28110227 | 3L | 1840989..1841201 | 356..144 | 465 | 81.2 | Minus |
| 3L | 28110227 | 3L | 8337917..8338105 | 163..351 | 375 | 79.9 | Plus |
| 2L | 23513712 | 2L | 9932732..9932865 | 333..200 | 205 | 76.9 | Minus |
Blast to na_te.dros performed on 2014-11-28 04:48:06 has no hits.
BO24986.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-03 13:59:32 Download gff for
BO24986.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG34461-RA | 161..574 | 17..432 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:09:05 Download gff for
BO24986.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG34461-RA | 165..578 | 17..432 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:57:39 Download gff for
BO24986.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG34461-RA | 165..578 | 17..432 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:57:39 Download gff for
BO24986.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3L | 8326144..8326379 | 17..254 | 98 | -> | Plus |
| 3L | 8326837..8327012 | 255..432 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:09:05 Download gff for
BO24986.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3L | 8319244..8319479 | 17..254 | 98 | -> | Plus |
| arm_3L | 8319937..8320112 | 255..432 | 98 | | Plus |
BO24986.pep Sequence
Translation from 16 to 448
> BO24986.pep
MKYFVAIALLFAAAQAVPIELGHYAPALVHHAPVLSHAVHAVHAEPVAYP
KYSFNYGIKDPHTGDIKSQAEERDGDVVKGQYSLVEPDGSVRTVDYTADD
HNGFNAVVHKTAPSKIIAHAPVLHAAPVLAHAPLLHHYASFLDH
BO24986.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:42:02
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG34461-PB | 138 | CG34461-PB | 1..138 | 1..138 | 731 | 100 | Plus |
| CG34461-PA | 138 | CG34461-PA | 1..138 | 1..138 | 731 | 100 | Plus |
| Cpr62Bc-PB | 180 | CG1919-PB | 5..148 | 2..140 | 360 | 54 | Plus |
| Cpr62Bc-PA | 180 | CG1919-PA | 5..148 | 2..140 | 360 | 54 | Plus |
| Cpr66Cb-PA | 162 | CG7076-PA | 58..162 | 20..138 | 322 | 58 | Plus |
