BO25129.complete Sequence
391 bp assembled on 2010-06-09
GenBank Submission: KX797484
> BO25129.complete
GAAGTTATCAGTCGACATGTGTTCCCGCAACATAAAGATCTCGGTGGTGC
TGTTTCTCGTCCTGATACCAATCTTCGCCGCCTTGCCACACAACCACAAT
CTGTCGAAGCGCAGCAACTTCTTCGACCTGGAGTGCAAGGGCATCTTCAA
CAAGACCATGTTCTTCCGACTGGACCGCATCTGCGAGGACTGCTACCAGT
TGTTCCGCGAGACGAGTATACACCGATTATGCAAGAAAGACTGCTTTGAT
TCAAAATGGTTTGGCGAATGCCTGAAAGTGCTGTTAATACCCGAAGAGGA
AATATCCAACCTACAGCACTTTCTGAGAGTAGTGAACGGCTCGCCCATAT
CCTTCAACATGGGGCCGCAAACAGCAAGCTTTCTAGACCAT
BO25129.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:51:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ITP-RG | 360 | CG13586-PG | 1..357 | 17..373 | 1770 | 99.7 | Plus |
ITP-RD | 360 | CG13586-PD | 1..357 | 17..373 | 1770 | 99.7 | Plus |
ITP-RF | 360 | CG13586-PF | 1..357 | 17..373 | 1770 | 99.7 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:51:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ITP-RG | 974 | CG13586-RG | 103..459 | 17..373 | 1770 | 99.7 | Plus |
ITP-RD | 3646 | CG13586-RD | 1081..1437 | 17..373 | 1770 | 99.7 | Plus |
ITP-RF | 1531 | CG13586-RF | 660..1016 | 17..373 | 1770 | 99.7 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:51:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 24555354..24555576 | 17..239 | 1085 | 99.1 | Plus |
2R | 25286936 | 2R | 24556284..24556422 | 235..373 | 695 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 02:51:50 has no hits.
BO25129.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-09 11:57:25 Download gff for
BO25129.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
itp-RD | 1050..1406 | 17..375 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:29:11 Download gff for
BO25129.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
itp-RF | 660..1016 | 17..375 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:37:35 Download gff for
BO25129.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ITP-RF | 660..1016 | 17..375 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:37:35 Download gff for
BO25129.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 24556284..24556422 | 235..375 | 98 | | Plus |
2R | 24555354..24555571 | 17..234 | 99 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:29:11 Download gff for
BO25129.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 20442877..20443094 | 17..234 | 99 | -> | Plus |
arm_2R | 20443807..20443945 | 235..375 | 98 | | Plus |
BO25129.pep Sequence
Translation from 16 to 391
> BO25129.pep
MCSRNIKISVVLFLVLIPIFAALPHNHNLSKRSNFFDLECKGIFNKTMFF
RLDRICEDCYQLFRETSIHRLCKKDCFDSKWFGECLKVLLIPEEEISNLQ
HFLRVVNGSPISFNMGPQTASFLDH
BO25129.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:00:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ITP-PG | 119 | CG13586-PG | 1..119 | 1..119 | 641 | 100 | Plus |
ITP-PD | 119 | CG13586-PD | 1..119 | 1..119 | 641 | 100 | Plus |
ITP-PF | 119 | CG13586-PF | 1..119 | 1..119 | 641 | 100 | Plus |
ITP-PC | 119 | CG13586-PC | 1..114 | 1..114 | 529 | 86 | Plus |
ITP-PE | 108 | CG13586-PE | 1..94 | 1..94 | 441 | 86.2 | Plus |