Clone BO25129 Report

Search the DGRC for BO25129

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:251
Well:29
Vector:pDNR-Dual
Associated Gene/Transcriptitp-RD
Protein status:BO25129.pep: Imported from assembly
Sequenced Size:391

Clone Sequence Records

BO25129.complete Sequence

391 bp assembled on 2010-06-09

GenBank Submission: KX797484

> BO25129.complete
GAAGTTATCAGTCGACATGTGTTCCCGCAACATAAAGATCTCGGTGGTGC
TGTTTCTCGTCCTGATACCAATCTTCGCCGCCTTGCCACACAACCACAAT
CTGTCGAAGCGCAGCAACTTCTTCGACCTGGAGTGCAAGGGCATCTTCAA
CAAGACCATGTTCTTCCGACTGGACCGCATCTGCGAGGACTGCTACCAGT
TGTTCCGCGAGACGAGTATACACCGATTATGCAAGAAAGACTGCTTTGAT
TCAAAATGGTTTGGCGAATGCCTGAAAGTGCTGTTAATACCCGAAGAGGA
AATATCCAACCTACAGCACTTTCTGAGAGTAGTGAACGGCTCGCCCATAT
CCTTCAACATGGGGCCGCAAACAGCAAGCTTTCTAGACCAT

BO25129.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:51:51
Subject Length Description Subject Range Query Range Score Percent Strand
ITP-RG 360 CG13586-PG 1..357 17..373 1770 99.7 Plus
ITP-RD 360 CG13586-PD 1..357 17..373 1770 99.7 Plus
ITP-RF 360 CG13586-PF 1..357 17..373 1770 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:51:52
Subject Length Description Subject Range Query Range Score Percent Strand
ITP-RG 974 CG13586-RG 103..459 17..373 1770 99.7 Plus
ITP-RD 3646 CG13586-RD 1081..1437 17..373 1770 99.7 Plus
ITP-RF 1531 CG13586-RF 660..1016 17..373 1770 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:51:49
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24555354..24555576 17..239 1085 99.1 Plus
2R 25286936 2R 24556284..24556422 235..373 695 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:51:50 has no hits.

BO25129.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-09 11:57:25 Download gff for BO25129.complete
Subject Subject Range Query Range Percent Splice Strand
itp-RD 1050..1406 17..375 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:29:11 Download gff for BO25129.complete
Subject Subject Range Query Range Percent Splice Strand
itp-RF 660..1016 17..375 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:37:35 Download gff for BO25129.complete
Subject Subject Range Query Range Percent Splice Strand
ITP-RF 660..1016 17..375 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:37:35 Download gff for BO25129.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24556284..24556422 235..375 98   Plus
2R 24555354..24555571 17..234 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:29:11 Download gff for BO25129.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20442877..20443094 17..234 99 -> Plus
arm_2R 20443807..20443945 235..375 98   Plus

BO25129.pep Sequence

Translation from 16 to 391

> BO25129.pep
MCSRNIKISVVLFLVLIPIFAALPHNHNLSKRSNFFDLECKGIFNKTMFF
RLDRICEDCYQLFRETSIHRLCKKDCFDSKWFGECLKVLLIPEEEISNLQ
HFLRVVNGSPISFNMGPQTASFLDH

BO25129.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:00:34
Subject Length Description Subject Range Query Range Score Percent Strand
ITP-PG 119 CG13586-PG 1..119 1..119 641 100 Plus
ITP-PD 119 CG13586-PD 1..119 1..119 641 100 Plus
ITP-PF 119 CG13586-PF 1..119 1..119 641 100 Plus
ITP-PC 119 CG13586-PC 1..114 1..114 529 86 Plus
ITP-PE 108 CG13586-PE 1..94 1..94 441 86.2 Plus