Clone BO25213 Report

Search the DGRC for BO25213

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:252
Well:13
Vector:pDNR-Dual
Associated Gene/TranscriptCG34193-RA
Protein status:BO25213.pep: Imported from assembly
Sequenced Size:265

Clone Sequence Records

BO25213.complete Sequence

265 bp assembled on 2010-06-09

GenBank Submission: KX798577

> BO25213.complete
GAAGTTATCAGTCGACATGAAAGTACTCCTGGCTTTAACTTTCCTGGCCA
CTTTGGCTCTTTCAGTGGCCCTTCCCCAGGTGGGACATGGATCTGTAAAT
GGACCCAGTGGGCGCTTCCCTATGACGAAGAATTGGGCGCAACCTCCGGT
TGATTTGCGAAAACCCATTATCTTTCTGCCAGAGGCCACGCCCATTCACG
AAGCCCAGGAGTCGCGCCCCCGACTAGCCAAACATCGCAAGAGTGGAGCA
AGCTTTCTAGACCAT

BO25213.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:52:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG34193-RB 234 CG34193-PB 1..231 17..247 1155 100 Plus
CG34193-RA 234 CG34193-PA 1..231 17..247 1155 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:52:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG34193-RB 2333 CG34193-RB 989..1219 17..247 1155 100 Plus
CG34193-RA 806 CG34193-RA 58..288 17..247 1155 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:52:28
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17510145..17510280 112..247 680 100 Plus
2R 25286936 2R 17509983..17510078 17..112 480 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:52:28 has no hits.

BO25213.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-09 11:57:36 Download gff for BO25213.complete
Subject Subject Range Query Range Percent Splice Strand
CG34193-RA 34..264 17..249 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:29:24 Download gff for BO25213.complete
Subject Subject Range Query Range Percent Splice Strand
CG34193-RA 40..270 17..249 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:37:49 Download gff for BO25213.complete
Subject Subject Range Query Range Percent Splice Strand
CG34193-RA 58..288 17..249 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:37:49 Download gff for BO25213.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17509983..17510078 17..112 100 -> Plus
2R 17510146..17510280 113..249 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:29:24 Download gff for BO25213.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13397488..13397583 17..112 100 -> Plus
arm_2R 13397651..13397785 113..249 98   Plus

BO25213.pep Sequence

Translation from 16 to 265

> BO25213.pep
MKVLLALTFLATLALSVALPQVGHGSVNGPSGRFPMTKNWAQPPVDLRKP
IIFLPEATPIHEAQESRPRLAKHRKSGASFLDH

BO25213.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:01:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG34193-PB 77 CG34193-PB 1..77 1..77 398 100 Plus
CG34193-PA 77 CG34193-PA 1..77 1..77 398 100 Plus