Clone BO25301 Report

Search the DGRC for BO25301

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:253
Well:1
Vector:pDNR-Dual
Associated Gene/TranscriptTfIIA-S-RA
Protein status:BO25301.pep: Imported from assembly
Sequenced Size:352

Clone Sequence Records

BO25301.complete Sequence

352 bp assembled on 2010-06-10

GenBank Submission: KX793814

> BO25301.complete
GAAGTTATCAGTCGACATGTCGTATCAACTGTACCGCAACACCACGCTCG
GCAACACCCTGCAGGAGAGCCTCGACGAGCTGATTCAGTACGGCCAGATT
ACGCCCGGACTGGCTTTCAAGGTTCTGCTGCAATTCGACAAGAGCATCAA
CAATGCCCTAAACCAGCGGGTCAAGGCCCGCGTCACCTTCAAGGCTGGAA
AACTAAACACCTACCGCTTCTGCGACAATGTCTGGACTCTCATGCTTAAC
GATGTGGAGTTCCGCGAAGTGCACGAGATCGTCAAGGTGGACAAGGTGAA
GATCGTGGCCTGCGACGGCAAGAGCGGCGAGTTCGCAAGCTTTCTAGACC
AT

BO25301.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 03:02:14
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIA-S-RA 321 CG5163-PA 1..318 17..334 1590 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:02:15
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIA-S-RA 617 CG5163-RA 106..423 17..334 1590 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 03:02:12
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23890582..23890830 334..86 1245 100 Minus
3R 32079331 3R 23890884..23890955 88..17 360 100 Minus
Blast to na_te.dros performed on 2014-11-28 03:02:13 has no hits.

BO25301.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-10 21:24:41 Download gff for BO25301.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIA-S-RA 102..419 17..336 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:33:32 Download gff for BO25301.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIA-S-RA 106..423 17..336 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:41:15 Download gff for BO25301.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIA-S-RA 106..423 17..336 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:41:15 Download gff for BO25301.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23890579..23890827 89..336 99 <- Minus
3R 23890884..23890955 17..88 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:33:32 Download gff for BO25301.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19716301..19716549 89..336 99 <- Minus
arm_3R 19716606..19716677 17..88 100   Minus

BO25301.pep Sequence

Translation from 16 to 352

> BO25301.pep
MSYQLYRNTTLGNTLQESLDELIQYGQITPGLAFKVLLQFDKSINNALNQ
RVKARVTFKAGKLNTYRFCDNVWTLMLNDVEFREVHEIVKVDKVKIVACD
GKSGEFASFLDH

BO25301.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 04:58:30
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIA-S-PA 106 CG5163-PA 1..106 1..106 547 100 Plus
TfIIA-S-2-PA 107 CG11639-PA 1..101 1..101 278 55.4 Plus