Clone BO25313 Report

Search the DGRC for BO25313

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:253
Well:13
Vector:pDNR-Dual
Associated Gene/Transcript
Protein status:BO25313.pep: Imported from assembly
Sequenced Size:268

Clone Sequence Records

BO25313.complete Sequence

268 bp assembled on 2010-06-10

> BO25313.complete
GAAGTTATCAGTCGACATGATGAGGAGACGGTGTACCGTGAAAACGGGAA
CTGCTGTGCCATTTAGACCAAACTGGCAACCTGTTACATATTTCAGCCAC
GTTAGCCAGGCGACACCTGAAGGTAATAACGGCAGGCCACCTGTTGCTGA
TCACAAAGACTACAGGAATTTGAAATTACTGACACAGTACCCAATACTAT
GCCCTTATTTATTCTTAGAACATATGTACATAAATACATTAATCGGCATT
GCAAGCTTTCTAGACCAT

BO25313.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-28 03:03:06 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed on 2014-11-28 03:03:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 03:03:04
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18842345..18842573 22..250 1145 100 Plus
Blast to na_te.dros performed 2014-11-28 03:03:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Ulysses 10653 Dvir\Ulysses DVULYSS 10653bp AKA(S37633) Derived from X56645 (Rel. 38, Last updated, Version 6). 3172..3271 163..261 110 58 Plus

BO25313.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-10 21:24:50 Download gff for BO25313.complete
Subject Subject Range Query Range Percent Splice Strand
CG32027-RA 619..851 17..252 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:41:34 Download gff for BO25313.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18842340..18842573 17..252 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:41:34 Download gff for BO25313.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18842340..18842573 17..252 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:33:53 Download gff for BO25313.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18835440..18835673 17..252 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:33:53 Download gff for BO25313.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18835440..18835673 17..252 97   Plus

BO25313.pep Sequence

Translation from 16 to 268

> BO25313.pep
MMRRRCTVKTGTAVPFRPNWQPVTYFSHVSQATPEGNNGRPPVADHKDYR
NLKLLTQYPILCPYLFLEHMYINTLIGIASFLDH
Sequence BO25313.pep has no blast hits.