Clone BO25339 Report

Search the DGRC for BO25339

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:253
Well:39
Vector:pDNR-Dual
Associated Gene/TranscriptRpL35-RA
Protein status:BO25339.pep: Imported from assembly
Sequenced Size:403

Clone Sequence Records

BO25339.complete Sequence

403 bp assembled on 2010-06-10

GenBank Submission: KX797914

> BO25339.complete
GAAGTTATCAGTCGACATGGTGAAGGTTAAGTGCTCCGAGCTGAGGATCA
AGGACAAGAAGGAACTCACCAAGCAATTGGATGAGCTCAAGAATGAGTTG
CTCAGCCTGCGCGTGGCCAAGGTGACCGGCGGAGCTCCCTCCAAGCTCTC
CAAGATCCGCGTTGTCCGCAAGGCCATCGCTCGCGTCTACATTGTGATGC
ACCAGAAGCAGAAGGAGAATCTGCGCAAGGTCTTCAAGAACAAGAAGTAC
AAGCCCCTGGATCTGCGCAAGAAGAAGACCCGCGCTATCCGCAAGGCCCT
GTCTCCGCGCGACGCCAACCGCAAGACCCTCAAGGAGATCCGCAAGCGCT
CCGTCTTCCCCCAGAGGAAGTTCGCCGTCAAGGCCGCAAGCTTTCTAGAC
CAT

BO25339.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 03:05:08
Subject Length Description Subject Range Query Range Score Percent Strand
RpL35-RC 372 CG4111-PC 1..369 17..385 1845 100 Plus
RpL35-RA 372 CG4111-PA 1..369 17..385 1845 100 Plus
RpL35-RB 372 CG4111-PB 1..369 17..385 1845 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:05:09
Subject Length Description Subject Range Query Range Score Percent Strand
RpL35-RC 590 CG4111-RC 120..488 17..385 1845 100 Plus
RpL35-RA 606 CG4111-RA 140..508 17..385 1845 100 Plus
RpL35-RB 507 CG4111-RB 41..409 17..385 1845 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 03:05:06
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 5673217..5673445 157..385 1145 100 Plus
X 23542271 X 5672997..5673134 19..156 690 100 Plus
Blast to na_te.dros performed on 2014-11-28 03:05:07 has no hits.

BO25339.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-10 21:25:11 Download gff for BO25339.complete
Subject Subject Range Query Range Percent Splice Strand
RpL35-RA 216..584 17..387 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:34:47 Download gff for BO25339.complete
Subject Subject Range Query Range Percent Splice Strand
RpL35-RB 41..409 17..387 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:42:21 Download gff for BO25339.complete
Subject Subject Range Query Range Percent Splice Strand
RpL35-RB 41..409 17..387 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:42:21 Download gff for BO25339.complete
Subject Subject Range Query Range Percent Splice Strand
X 5672996..5673134 17..156 99 -> Plus
X 5673217..5673445 157..387 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:34:47 Download gff for BO25339.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 5567029..5567167 17..156 99 -> Plus
arm_X 5567250..5567478 157..387 99   Plus

BO25339.pep Sequence

Translation from 16 to 403

> BO25339.pep
MVKVKCSELRIKDKKELTKQLDELKNELLSLRVAKVTGGAPSKLSKIRVV
RKAIARVYIVMHQKQKENLRKVFKNKKYKPLDLRKKKTRAIRKALSPRDA
NRKTLKEIRKRSVFPQRKFAVKAASFLDH

BO25339.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:00:11
Subject Length Description Subject Range Query Range Score Percent Strand
RpL35-PC 123 CG4111-PC 1..123 1..123 602 100 Plus
RpL35-PA 123 CG4111-PA 1..123 1..123 602 100 Plus
RpL35-PB 123 CG4111-PB 1..123 1..123 602 100 Plus