BO25339.complete Sequence
403 bp assembled on 2010-06-10
GenBank Submission: KX797914
> BO25339.complete
GAAGTTATCAGTCGACATGGTGAAGGTTAAGTGCTCCGAGCTGAGGATCA
AGGACAAGAAGGAACTCACCAAGCAATTGGATGAGCTCAAGAATGAGTTG
CTCAGCCTGCGCGTGGCCAAGGTGACCGGCGGAGCTCCCTCCAAGCTCTC
CAAGATCCGCGTTGTCCGCAAGGCCATCGCTCGCGTCTACATTGTGATGC
ACCAGAAGCAGAAGGAGAATCTGCGCAAGGTCTTCAAGAACAAGAAGTAC
AAGCCCCTGGATCTGCGCAAGAAGAAGACCCGCGCTATCCGCAAGGCCCT
GTCTCCGCGCGACGCCAACCGCAAGACCCTCAAGGAGATCCGCAAGCGCT
CCGTCTTCCCCCAGAGGAAGTTCGCCGTCAAGGCCGCAAGCTTTCTAGAC
CAT
BO25339.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 03:05:08
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
| RpL35-RC | 372 | CG4111-PC | 1..369 | 17..385 | 1845 | 100 | Plus |
| RpL35-RA | 372 | CG4111-PA | 1..369 | 17..385 | 1845 | 100 | Plus |
| RpL35-RB | 372 | CG4111-PB | 1..369 | 17..385 | 1845 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:05:09
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
| RpL35-RC | 590 | CG4111-RC | 120..488 | 17..385 | 1845 | 100 | Plus |
| RpL35-RA | 606 | CG4111-RA | 140..508 | 17..385 | 1845 | 100 | Plus |
| RpL35-RB | 507 | CG4111-RB | 41..409 | 17..385 | 1845 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 03:05:06
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
| X | 23542271 | X | 5673217..5673445 | 157..385 | 1145 | 100 | Plus |
| X | 23542271 | X | 5672997..5673134 | 19..156 | 690 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 03:05:07 has no hits.
BO25339.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-10 21:25:11 Download gff for
BO25339.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
| RpL35-RA | 216..584 | 17..387 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:34:47 Download gff for
BO25339.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
| RpL35-RB | 41..409 | 17..387 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:42:21 Download gff for
BO25339.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
| RpL35-RB | 41..409 | 17..387 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:42:21 Download gff for
BO25339.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
| X | 5672996..5673134 | 17..156 | 99 | -> | Plus |
| X | 5673217..5673445 | 157..387 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:34:47 Download gff for
BO25339.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
| arm_X | 5567029..5567167 | 17..156 | 99 | -> | Plus |
| arm_X | 5567250..5567478 | 157..387 | 99 | | Plus |
BO25339.pep Sequence
Translation from 16 to 403
> BO25339.pep
MVKVKCSELRIKDKKELTKQLDELKNELLSLRVAKVTGGAPSKLSKIRVV
RKAIARVYIVMHQKQKENLRKVFKNKKYKPLDLRKKKTRAIRKALSPRDA
NRKTLKEIRKRSVFPQRKFAVKAASFLDH
BO25339.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:00:11
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
| RpL35-PC | 123 | CG4111-PC | 1..123 | 1..123 | 602 | 100 | Plus |
| RpL35-PA | 123 | CG4111-PA | 1..123 | 1..123 | 602 | 100 | Plus |
| RpL35-PB | 123 | CG4111-PB | 1..123 | 1..123 | 602 | 100 | Plus |