Clone BO25344 Report

Search the DGRC for BO25344

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:253
Well:44
Vector:pDNR-Dual
Associated Gene/Transcriptskl-RA
Protein status:BO25344.pep: Imported from assembly
Sequenced Size:358

Clone Sequence Records

BO25344.complete Sequence

358 bp assembled on 2010-06-10

GenBank Submission: KX797976

> BO25344.complete
GAAGTTATCAGTCGACATGGCCATTCCATTTTTCGAAGAAGAGCACGCCC
CGAAATCGGAACCCAGTGGCGATCAAGTCGATAGCCCCATGGCTTTCTCC
ATAGACCCCGGACATGATCAAGTGGACTTTGAAGGACCTCCGTCTGCAGC
AGAGGAACTCCCGCCACCAGGAGCAACAAGTGAGCCAGTTGCGCCTCCGA
GTGCCGAGGAGCAACTGCTGGCCTGGAAATTCCTGGCCATCACCATGTGC
AAGGTCCTGAAGCAATTTTACCAACAGCACAAGTCGTCCGGAAAATCCAG
CAAACTAAAGGCCACCGTTCAAATACAACCGCAGGCGCAGGCAAGCTTTC
TAGACCAT

BO25344.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:57:49
Subject Length Description Subject Range Query Range Score Percent Strand
skl-RA 327 CG13701-PA 1..324 17..340 1620 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:57:50
Subject Length Description Subject Range Query Range Score Percent Strand
skl-RA 1382 CG13701-RA 116..439 17..340 1620 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:57:47
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18439504..18439827 340..17 1620 100 Minus
Blast to na_te.dros performed on 2014-11-28 02:57:48 has no hits.

BO25344.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-10 21:24:12 Download gff for BO25344.complete
Subject Subject Range Query Range Percent Splice Strand
skl-RA 111..434 17..342 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:31:27 Download gff for BO25344.complete
Subject Subject Range Query Range Percent Splice Strand
skl-RA 116..439 17..342 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:39:38 Download gff for BO25344.complete
Subject Subject Range Query Range Percent Splice Strand
skl-RA 116..439 17..342 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:39:38 Download gff for BO25344.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18439502..18439827 17..342 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:31:27 Download gff for BO25344.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18432602..18432927 17..342 99   Minus

BO25344.pep Sequence

Translation from 16 to 358

> BO25344.pep
MAIPFFEEEHAPKSEPSGDQVDSPMAFSIDPGHDQVDFEGPPSAAEELPP
PGATSEPVAPPSAEEQLLAWKFLAITMCKVLKQFYQQHKSSGKSSKLKAT
VQIQPQAQASFLDH

BO25344.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 03:03:57
Subject Length Description Subject Range Query Range Score Percent Strand
skl-PA 108 CG13701-PA 1..108 1..108 567 100 Plus