BO25347.complete Sequence
301 bp assembled on 2010-06-10
GenBank Submission: KX797412
> BO25347.complete
GAAGTTATCAGTCGACATGGTATCCGAGTGGGTGGCACCAATCGTTATCA
CCAGCATTTGGGCCTTCATTGGCATCATCTGCCCCTTCTTCGCCCGAGGA
CCCAACAGGGGGGTGACTCAATGCTGCCTGATGCTCACCGCAGCAACTTG
CTGGCTGTTCTGGCTGTGCTGCTACATGACGCAGCTGAACCCCCTCATCG
GACCCAAACTAAGCATGAACGAAATCATGATCATGGCCCGCGAGTGGGGC
AATGAGATCAAGGACACCATGGCTGTCACCGTCGCAAGCTTTCTAGACCA
T
BO25347.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:57:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
VhaM9.7-b-RB | 270 | CG7625-PB | 1..267 | 17..283 | 1335 | 100 | Plus |
VhaM9.7-b-RA | 270 | CG7625-PA | 1..267 | 17..283 | 1335 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:58:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
VhaM9.7-b-RB | 1216 | CG7625-RB | 127..393 | 17..283 | 1335 | 100 | Plus |
VhaM9.7-b-RA | 699 | CG7625-RA | 127..393 | 17..283 | 1335 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:57:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 21540269..21540392 | 160..283 | 620 | 100 | Plus |
3L | 28110227 | 3L | 21539988..21540083 | 17..112 | 480 | 100 | Plus |
3L | 28110227 | 3L | 21540152..21540200 | 111..159 | 245 | 100 | Plus |
3R | 32079331 | 3R | 3580243..3580286 | 280..237 | 220 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 02:57:58 has no hits.
BO25347.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-10 21:24:14 Download gff for
BO25347.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
VhaM9.7-2-RA | 127..393 | 17..285 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:31:32 Download gff for
BO25347.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
VhaM9.7-b-RA | 127..393 | 17..285 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:39:41 Download gff for
BO25347.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
VhaM9.7-b-RA | 127..393 | 17..285 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:39:41 Download gff for
BO25347.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 21539988..21540082 | 17..111 | 100 | -> | Plus |
3L | 21540153..21540200 | 112..159 | 100 | -> | Plus |
3L | 21540269..21540392 | 160..285 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:31:32 Download gff for
BO25347.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 21533088..21533182 | 17..111 | 100 | -> | Plus |
arm_3L | 21533253..21533300 | 112..159 | 100 | -> | Plus |
arm_3L | 21533369..21533492 | 160..285 | 98 | | Plus |
BO25347.pep Sequence
Translation from 16 to 301
> BO25347.pep
MVSEWVAPIVITSIWAFIGIICPFFARGPNRGVTQCCLMLTAATCWLFWL
CCYMTQLNPLIGPKLSMNEIMIMAREWGNEIKDTMAVTVASFLDH
BO25347.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 03:04:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
VhaM9.7-b-PB | 89 | CG7625-PB | 1..89 | 1..89 | 492 | 100 | Plus |
VhaM9.7-b-PA | 89 | CG7625-PA | 1..89 | 1..89 | 492 | 100 | Plus |
VhaM9.7-a-PC | 85 | CG1268-PC | 9..82 | 9..81 | 226 | 50 | Plus |
VhaM9.7-a-PB | 85 | CG1268-PB | 9..82 | 9..81 | 226 | 50 | Plus |
VhaM9.7-c-PA | 84 | CG11589-PA | 8..83 | 9..83 | 214 | 48.7 | Plus |