Clone BO25358 Report

Search the DGRC for BO25358

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:253
Well:58
Vector:pDNR-Dual
Associated Gene/TranscriptCG9336-RA
Protein status:BO25358.pep: Imported from assembly
Sequenced Size:478

Clone Sequence Records

BO25358.complete Sequence

478 bp assembled on 2010-06-10

GenBank Submission: KX797895

> BO25358.complete
GAAGTTATCAGTCGACATGGTGTCCGCTCTGAAATGCAGTTTGGCCGTGG
CCGTTATGATCAGTCTGGCTTGTTCGGCCTACGCCATCAAGTGCTACCAG
TGCGAGTCCCTCACAATGCCCAAGTGTGGCCTGAAGTTCGAGGCTGATGA
GACGTTGCTGCTGGACTGCTCCAGGATCGGACCCCCACGCTACCTGCAGA
ACTTCTTCCCCCTGCGGAACGCCACTGGTTGCATGAAGAAGACCCTCGAA
AGCGTGGCCGGACATCCGCAGATCGTGAGGAGCTGCTACTTCGGGGACAT
CAACAATATCCAAGCTGGCTGCCAGTCGGATCCCTCTATGCCGTTCGTTA
AGCAGCTGGGCTGCGATGTCTGCACCAAGGACGAGTGCAACGGATCCTCC
TCCCTGGCCCCCATCGCCGGAGCCATCCTGCTCTTCTTCGGCGTGGCTCG
TCTGCTGGCCGCAAGCTTTCTAGACCAT

BO25358.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 03:00:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG9336-RA 447 CG9336-PA 1..444 17..460 2220 100 Plus
CG9336-RB 348 CG9336-PB 1..345 116..460 1725 100 Plus
CG9338-RB 444 CG9338-PB 146..441 162..460 425 76.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:00:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG9336-RA 678 CG9336-RA 108..551 17..460 2220 100 Plus
CG9336-RB 636 CG9336-RB 126..509 77..460 1920 100 Plus
CG9338-RB 1087 CG9338-RB 224..519 162..460 425 76.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 03:00:01
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20860681..20860887 254..460 1035 100 Plus
2L 23513712 2L 20859724..20859901 77..254 890 100 Plus
2L 23513712 2L 20866947..20867141 266..460 345 78.5 Plus
2L 23513712 2L 20859273..20859333 17..77 305 100 Plus
Blast to na_te.dros performed on 2014-11-28 03:00:02 has no hits.

BO25358.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-10 21:24:25 Download gff for BO25358.complete
Subject Subject Range Query Range Percent Splice Strand
CG9336-RA 105..548 17..462 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:32:30 Download gff for BO25358.complete
Subject Subject Range Query Range Percent Splice Strand
CG9336-RA 108..551 17..462 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:40:26 Download gff for BO25358.complete
Subject Subject Range Query Range Percent Splice Strand
CG9336-RA 108..551 17..462 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:40:26 Download gff for BO25358.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20859273..20859333 17..77 100 -> Plus
2L 20859725..20859901 78..254 100 -> Plus
2L 20860682..20860887 255..462 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:32:30 Download gff for BO25358.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20859273..20859333 17..77 100 -> Plus
arm_2L 20859725..20859901 78..254 100 -> Plus
arm_2L 20860682..20860887 255..462 99   Plus

BO25358.pep Sequence

Translation from 16 to 478

> BO25358.pep
MVSALKCSLAVAVMISLACSAYAIKCYQCESLTMPKCGLKFEADETLLLD
CSRIGPPRYLQNFFPLRNATGCMKKTLESVAGHPQIVRSCYFGDINNIQA
GCQSDPSMPFVKQLGCDVCTKDECNGSSSLAPIAGAILLFFGVARLLAAS
FLDH

BO25358.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 03:05:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG9336-PA 148 CG9336-PA 1..148 1..148 782 100 Plus
CG9336-PB 115 CG9336-PB 1..115 34..148 617 100 Plus
CG9338-PB 147 CG9338-PB 1..147 1..148 524 62.8 Plus
CG9338-PA 147 CG9338-PA 1..147 1..148 524 62.8 Plus
CG31675-PA 148 CG31675-PA 6..148 9..147 267 40.3 Plus