Clone BO25368 Report

Search the DGRC for BO25368

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:253
Well:68
Vector:pDNR-Dual
Associated Gene/TranscriptCG14324-RA
Protein status:BO25368.pep: Imported from assembly
Sequenced Size:427

Clone Sequence Records

BO25368.complete Sequence

427 bp assembled on 2010-06-10

GenBank Submission: KX795525

> BO25368.complete
GAAGTTATCAGTCGACATGAGGCAAAACAAGATAACGATTTTGGGTCTGT
CCCTGCTGCTTTGTTTGGCGCTTGCACACTCACATGGTTTTGGTGGAAAG
CTTGGAGGAGGCTACGCCCCTGTCTACAACAACTTTGTCCCATATCCAGT
TGCCCAACCGATCCCAGTGGCCCAACCTGTTCCAGTTCCCGTGGCTATTC
CTCAACCAATTCCAGTCCCAGTCCCCCAACCAGTAGTTATTCCCATCAAA
CACGGATGGAAGGGTGGTCTAGGTCTAGGTGGATTTGGCGGAGGTTATGG
CGGCGGTTTCGGAGGCTACCAGAACTTTGCCTCTGCCTCCTCTTTTAGCT
CTGCCAGTTCATTTGGCGGTGGCTATGGCGGATTGGGTGGTGGCACCTTT
AGGCGGCGCGCAAGCTTTCTAGACCAT

BO25368.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 03:01:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG14324-RA 396 CG14324-PA 1..393 17..409 1965 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:01:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG14324-RA 464 CG14324-RA 23..417 15..409 1975 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 03:01:25
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17618328..17618707 409..30 1900 100 Minus
Blast to na_te.dros performed on 2014-11-28 03:01:26 has no hits.

BO25368.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-10 21:24:37 Download gff for BO25368.complete
Subject Subject Range Query Range Percent Splice Strand
CG14324-RA 17..409 17..411 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:33:13 Download gff for BO25368.complete
Subject Subject Range Query Range Percent Splice Strand
CG14324-RA 25..417 17..411 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:40:57 Download gff for BO25368.complete
Subject Subject Range Query Range Percent Splice Strand
CG14324-RA 25..417 17..411 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:40:57 Download gff for BO25368.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17618325..17618705 32..411 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:33:13 Download gff for BO25368.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13444047..13444427 32..411 99 <- Minus

BO25368.pep Sequence

Translation from 16 to 427

> BO25368.pep
MRQNKITILGLSLLLCLALAHSHGFGGKLGGGYAPVYNNFVPYPVAQPIP
VAQPVPVPVAIPQPIPVPVPQPVVIPIKHGWKGGLGLGGFGGGYGGGFGG
YQNFASASSFSSASSFGGGYGGLGGGTFRRRASFLDH

BO25368.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 04:58:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG14324-PA 131 CG14324-PA 1..131 1..131 710 100 Plus
CG5070-PA 209 CG5070-PA 90..190 24..125 152 35 Plus
CG10853-PA 155 CG10853-PA 27..92 53..130 137 45.6 Plus