Clone BO25503 Report

Search the DGRC for BO25503

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:255
Well:3
Vector:pDNR-Dual
Associated Gene/TranscriptCG17580-RA
Protein status:BO25503.pep: Imported from assembly
Sequenced Size:253

Clone Sequence Records

BO25503.complete Sequence

253 bp assembled on 2010-06-28

GenBank Submission: KX794490

> BO25503.complete
GAAGTTATCAGTCGACATGGGAAACAAGCTGCGCCGCCAACCACAAAGAG
TTGAAGTTGACGAGGAGGAGGTGAGATCCGACCGACCCCAGAAGAAGCCA
CCATCGTCATGGCCCTTCTGGCGCCTGGTCTACTGGCTGGGAGTCCTCAT
CATGGTCATCGGCATCGGTGTGGGCATGTACTTCACCCTCAAGTCGGACT
TCGGTGAGTGCTCCTCCTACGACGTCCGTTGCGATGCAAGCTTTCTAGAC
CAT

BO25503.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:54:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG17580-RA 222 CG17580-PA 1..219 17..235 1095 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:54:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG17580-RA 1086 CG17580-RA 85..303 17..235 1095 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:54:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12806698..12806916 17..235 1095 100 Plus
Blast to na_te.dros performed on 2014-11-28 08:54:35 has no hits.

BO25503.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-28 17:10:59 Download gff for BO25503.complete
Subject Subject Range Query Range Percent Splice Strand
CG17580-RA 22..240 17..237 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:31:23 Download gff for BO25503.complete
Subject Subject Range Query Range Percent Splice Strand
CG17580-RA 85..303 17..237 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:27:16 Download gff for BO25503.complete
Subject Subject Range Query Range Percent Splice Strand
CG17580-RA 85..303 17..237 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:27:16 Download gff for BO25503.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12806698..12806916 17..237 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:31:23 Download gff for BO25503.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8694203..8694421 17..237 99   Plus

BO25503.pep Sequence

Translation from 16 to 253

> BO25503.pep
MGNKLRRQPQRVEVDEEEVRSDRPQKKPPSSWPFWRLVYWLGVLIMVIGI
GVGMYFTLKSDFGECSSYDVRCDASFLDH

BO25503.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:10:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG17580-PA 73 CG17580-PA 1..73 1..73 400 100 Plus