Clone BO25504 Report

Search the DGRC for BO25504

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:255
Well:4
Vector:pDNR-Dual
Associated Gene/TranscriptCG31870-RA
Protein status:BO25504.pep: Imported from assembly
Sequenced Size:271

Clone Sequence Records

BO25504.complete Sequence

271 bp assembled on 2010-06-28

GenBank Submission: KX799508

> BO25504.complete
GAAGTTATCAGTCGACATGTCTAGGAACTATGGACCTGGACCTGGAGCCT
ACATGCTACCCAGCAGTTTTGGACAAAAAGGACCTCAGTTCTCCTTCGGC
CGCAGAATTGACCGCAAAAGAGATGAAAAACCTGGTCCGGGTCCTGCTGC
TTATAAGGTGGATAAAGTGACACGCTACGGAAACGCGGAGGGTCCACAGT
TTTCCATGTATGTTAGGAACTCCAAGATGAAACCCCTCCCCATTCGATTG
TCTGCAAGCTTTCTAGACCAT

BO25504.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:54:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG31870-RD 240 CG31870-PD 1..237 17..253 1170 99.6 Plus
CG31870-RA 240 CG31870-PA 1..237 17..253 1170 99.6 Plus
CG31870-RE 204 CG31870-PE 1..201 53..253 990 99.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:54:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG31870-RD 1097 CG31870-RD 129..367 15..253 1180 99.6 Plus
CG31870-RA 478 CG31870-RA 129..367 15..253 1180 99.6 Plus
CG31870-RE 537 CG31870-RE 205..426 32..253 1095 99.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:54:29
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10790426..10790647 32..253 1095 99.5 Plus
Blast to na_te.dros performed on 2014-11-28 08:54:30 has no hits.

BO25504.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-28 17:10:58 Download gff for BO25504.complete
Subject Subject Range Query Range Percent Splice Strand
CG31870-RA 111..347 17..255 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:31:21 Download gff for BO25504.complete
Subject Subject Range Query Range Percent Splice Strand
CG31870-RA 131..367 17..255 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:27:14 Download gff for BO25504.complete
Subject Subject Range Query Range Percent Splice Strand
CG31870-RA 131..367 17..255 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:27:14 Download gff for BO25504.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10790352..10790367 17..32 100 -> Plus
2L 10790427..10790647 33..255 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:31:21 Download gff for BO25504.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10790352..10790367 17..32 100 -> Plus
arm_2L 10790427..10790647 33..255 98   Plus

BO25504.pep Sequence

Translation from 16 to 271

> BO25504.pep
MSRNYGPGPGAYMLPSSFGQKGPQFSFGRRIDRKRDEKPGPGPAAYKVDK
VTRYGNAEGPQFSMYVRNSKMKPLPIRLSASFLDH

BO25504.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:10:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG31870-PD 79 CG31870-PD 1..79 1..79 426 100 Plus
CG31870-PA 79 CG31870-PA 1..79 1..79 426 100 Plus
CG31870-PE 67 CG31870-PE 1..67 13..79 356 100 Plus
CG31870-PC 67 CG31870-PC 1..67 13..79 356 100 Plus
CG10252-PA 229 CG10252-PA 4..77 3..69 179 52 Plus