BO25504.complete Sequence
271 bp assembled on 2010-06-28
GenBank Submission: KX799508
> BO25504.complete
GAAGTTATCAGTCGACATGTCTAGGAACTATGGACCTGGACCTGGAGCCT
ACATGCTACCCAGCAGTTTTGGACAAAAAGGACCTCAGTTCTCCTTCGGC
CGCAGAATTGACCGCAAAAGAGATGAAAAACCTGGTCCGGGTCCTGCTGC
TTATAAGGTGGATAAAGTGACACGCTACGGAAACGCGGAGGGTCCACAGT
TTTCCATGTATGTTAGGAACTCCAAGATGAAACCCCTCCCCATTCGATTG
TCTGCAAGCTTTCTAGACCAT
BO25504.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:54:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31870-RD | 240 | CG31870-PD | 1..237 | 17..253 | 1170 | 99.6 | Plus |
CG31870-RA | 240 | CG31870-PA | 1..237 | 17..253 | 1170 | 99.6 | Plus |
CG31870-RE | 204 | CG31870-PE | 1..201 | 53..253 | 990 | 99.5 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:54:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31870-RD | 1097 | CG31870-RD | 129..367 | 15..253 | 1180 | 99.6 | Plus |
CG31870-RA | 478 | CG31870-RA | 129..367 | 15..253 | 1180 | 99.6 | Plus |
CG31870-RE | 537 | CG31870-RE | 205..426 | 32..253 | 1095 | 99.5 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:54:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 10790426..10790647 | 32..253 | 1095 | 99.5 | Plus |
Blast to na_te.dros performed on 2014-11-28 08:54:30 has no hits.
BO25504.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-28 17:10:58 Download gff for
BO25504.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31870-RA | 111..347 | 17..255 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:31:21 Download gff for
BO25504.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31870-RA | 131..367 | 17..255 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:27:14 Download gff for
BO25504.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31870-RA | 131..367 | 17..255 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:27:14 Download gff for
BO25504.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 10790352..10790367 | 17..32 | 100 | -> | Plus |
2L | 10790427..10790647 | 33..255 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:31:21 Download gff for
BO25504.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 10790352..10790367 | 17..32 | 100 | -> | Plus |
arm_2L | 10790427..10790647 | 33..255 | 98 | | Plus |
BO25504.pep Sequence
Translation from 16 to 271
> BO25504.pep
MSRNYGPGPGAYMLPSSFGQKGPQFSFGRRIDRKRDEKPGPGPAAYKVDK
VTRYGNAEGPQFSMYVRNSKMKPLPIRLSASFLDH
BO25504.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:10:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31870-PD | 79 | CG31870-PD | 1..79 | 1..79 | 426 | 100 | Plus |
CG31870-PA | 79 | CG31870-PA | 1..79 | 1..79 | 426 | 100 | Plus |
CG31870-PE | 67 | CG31870-PE | 1..67 | 13..79 | 356 | 100 | Plus |
CG31870-PC | 67 | CG31870-PC | 1..67 | 13..79 | 356 | 100 | Plus |
CG10252-PA | 229 | CG10252-PA | 4..77 | 3..69 | 179 | 52 | Plus |