Clone BO25510 Report

Search the DGRC for BO25510

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:255
Well:10
Vector:pDNR-Dual
Associated Gene/TranscriptCG30109-RA
Protein status:BO25510.pep: Imported from assembly
Sequenced Size:298

Clone Sequence Records

BO25510.complete Sequence

298 bp assembled on 2010-06-28

GenBank Submission: KX799518

> BO25510.complete
GAAGTTATCAGTCGACATGAACAGCATTGGCGAGGATTGCAATGAGCTAA
AGAAGCAGTACGACGCCTGCTTCAACAGCTGGTTCTCGGAAGGCTTCCTT
AAGGGCCAGACGGATGACTCGGGCTGCGCGCCGATTTTCCGGGTCTATCA
GGAGTGCGTCAAGCGCGCCATGAGGGAGCAAAAGATTGAGCTGCGGGAGG
TCGGATCTGAGTACTGCACCGGCTCGGAGTACGACAATGCGAGTAGTTCC
GGCGGAAAGACGCAACCCAAGACAAAAAGTGCAAGCTTTCTAGACCAT

BO25510.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:54:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG30109-RB 267 CG30109-PB 1..264 17..280 1320 100 Plus
CG30108-RB 267 CG30108-PB 1..170 17..186 445 84.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:54:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG30109-RB 609 CG30109-RB 101..364 17..280 1320 100 Plus
CG30108-RB 552 CG30108-RB 92..261 17..186 445 84.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:54:39
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17670182..17670328 17..163 735 100 Plus
2R 25286936 2R 17670385..17670503 162..280 595 100 Plus
2R 25286936 2R 17669486..17669632 17..163 405 85 Plus
Blast to na_te.dros performed on 2014-11-28 08:54:41 has no hits.

BO25510.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-28 17:11:05 Download gff for BO25510.complete
Subject Subject Range Query Range Percent Splice Strand
CG30109-RA 1..264 17..282 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:31:25 Download gff for BO25510.complete
Subject Subject Range Query Range Percent Splice Strand
CG30109-RB 101..364 17..282 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:27:17 Download gff for BO25510.complete
Subject Subject Range Query Range Percent Splice Strand
CG30109-RB 101..364 17..282 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:27:17 Download gff for BO25510.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17670387..17670503 164..282 98   Plus
2R 17670182..17670328 17..163 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:31:25 Download gff for BO25510.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13557687..13557833 17..163 100 -> Plus
arm_2R 13557892..13558008 164..282 98   Plus

BO25510.pep Sequence

Translation from 16 to 298

> BO25510.pep
MNSIGEDCNELKKQYDACFNSWFSEGFLKGQTDDSGCAPIFRVYQECVKR
AMREQKIELREVGSEYCTGSEYDNASSSGGKTQPKTKSASFLDH

BO25510.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:10:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG30109-PB 88 CG30109-PB 1..88 1..88 476 100 Plus
CG30108-PB 88 CG30108-PB 1..88 1..88 318 67 Plus