BO25510.complete Sequence
298 bp assembled on 2010-06-28
GenBank Submission: KX799518
> BO25510.complete
GAAGTTATCAGTCGACATGAACAGCATTGGCGAGGATTGCAATGAGCTAA
AGAAGCAGTACGACGCCTGCTTCAACAGCTGGTTCTCGGAAGGCTTCCTT
AAGGGCCAGACGGATGACTCGGGCTGCGCGCCGATTTTCCGGGTCTATCA
GGAGTGCGTCAAGCGCGCCATGAGGGAGCAAAAGATTGAGCTGCGGGAGG
TCGGATCTGAGTACTGCACCGGCTCGGAGTACGACAATGCGAGTAGTTCC
GGCGGAAAGACGCAACCCAAGACAAAAAGTGCAAGCTTTCTAGACCAT
BO25510.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:54:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30109-RB | 267 | CG30109-PB | 1..264 | 17..280 | 1320 | 100 | Plus |
CG30108-RB | 267 | CG30108-PB | 1..170 | 17..186 | 445 | 84.1 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:54:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30109-RB | 609 | CG30109-RB | 101..364 | 17..280 | 1320 | 100 | Plus |
CG30108-RB | 552 | CG30108-RB | 92..261 | 17..186 | 445 | 84.1 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:54:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 17670182..17670328 | 17..163 | 735 | 100 | Plus |
2R | 25286936 | 2R | 17670385..17670503 | 162..280 | 595 | 100 | Plus |
2R | 25286936 | 2R | 17669486..17669632 | 17..163 | 405 | 85 | Plus |
Blast to na_te.dros performed on 2014-11-28 08:54:41 has no hits.
BO25510.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-28 17:11:05 Download gff for
BO25510.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30109-RA | 1..264 | 17..282 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:31:25 Download gff for
BO25510.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30109-RB | 101..364 | 17..282 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:27:17 Download gff for
BO25510.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30109-RB | 101..364 | 17..282 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:27:17 Download gff for
BO25510.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 17670387..17670503 | 164..282 | 98 | | Plus |
2R | 17670182..17670328 | 17..163 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:31:25 Download gff for
BO25510.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 13557687..13557833 | 17..163 | 100 | -> | Plus |
arm_2R | 13557892..13558008 | 164..282 | 98 | | Plus |
BO25510.pep Sequence
Translation from 16 to 298
> BO25510.pep
MNSIGEDCNELKKQYDACFNSWFSEGFLKGQTDDSGCAPIFRVYQECVKR
AMREQKIELREVGSEYCTGSEYDNASSSGGKTQPKTKSASFLDH
BO25510.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:10:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30109-PB | 88 | CG30109-PB | 1..88 | 1..88 | 476 | 100 | Plus |
CG30108-PB | 88 | CG30108-PB | 1..88 | 1..88 | 318 | 67 | Plus |