BO25546.complete Sequence
409 bp assembled on 2010-06-28
> BO25546.complete
GAAGTTATCAGTCGACATGTACAATAGTTTATATTTATATCGAAATCTGT
GCAAAATGTCGTTTGTTCCAGAGACTTTTATTATTTATGGCTTTTTATGG
AGCTTGGTGGTTTTCCCAGCTTTCGCTAATTTTTCCCTCTACAACTACGG
GGATTCAGCCTATCCCAATTGCTGTGTTCTCGATATTGACTCAACGCGGA
TACTGCTTAAAATGGGTCAGAAATTTCGCCCAAAATTCCTGCCCTGCACG
ACAATTTTATGCATTGGCGATGGATATGGAATGCTGTTTACGTGTGATAA
AAAGGAACCACCAGAGCACTGTCACTTTAAGGATTATTTGAATGGGGATG
CCAATTATCCAGATTGTTGCTACCGCAAACTTGAGTGCGACGCAAGCTTT
CTAGACCAT
BO25546.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:53:21
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG34178-RC | 339 | CG34178-PC | 1..336 | 56..391 | 1680 | 100 | Plus |
| CG34178-RB | 339 | CG34178-PB | 1..336 | 56..391 | 1680 | 100 | Plus |
| CG34178-RA | 339 | CG34178-PA | 1..336 | 56..391 | 1680 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:53:22
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG34178-RC | 492 | CG34178-RC | 14..388 | 17..391 | 1875 | 100 | Plus |
| CG34178-RB | 940 | CG34178-RB | 462..836 | 17..391 | 1875 | 100 | Plus |
| CG34178-RA | 882 | CG34178-RA | 404..778 | 17..391 | 1875 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:53:19
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2L | 23513712 | 2L | 4434428..4434569 | 17..158 | 710 | 100 | Plus |
| 2L | 23513712 | 2L | 4434616..4434755 | 154..293 | 700 | 100 | Plus |
| 2L | 23513712 | 2L | 4434854..4434953 | 292..391 | 500 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 08:53:20 has no hits.
BO25546.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-28 17:10:42 Download gff for
BO25546.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG34178-RA | 404..778 | 17..393 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:30:52 Download gff for
BO25546.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG34178-RA | 404..778 | 17..393 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:26:55 Download gff for
BO25546.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG34178-RA | 404..778 | 17..393 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:26:55 Download gff for
BO25546.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2L | 4434428..4434569 | 17..158 | 100 | -> | Plus |
| 2L | 4434621..4434753 | 159..291 | 100 | -> | Plus |
| 2L | 4434854..4434953 | 292..393 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:30:52 Download gff for
BO25546.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2L | 4434428..4434569 | 17..158 | 100 | -> | Plus |
| arm_2L | 4434621..4434753 | 159..291 | 100 | -> | Plus |
| arm_2L | 4434854..4434953 | 292..393 | 98 | | Plus |
BO25546.pep Sequence
Translation from 16 to 409
> BO25546.pep
MYNSLYLYRNLCKMSFVPETFIIYGFLWSLVVFPAFANFSLYNYGDSAYP
NCCVLDIDSTRILLKMGQKFRPKFLPCTTILCIGDGYGMLFTCDKKEPPE
HCHFKDYLNGDANYPDCCYRKLECDASFLDH
BO25546.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:08:09
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG34178-PC | 112 | CG34178-PC | 1..112 | 14..125 | 641 | 100 | Plus |
| CG34178-PB | 112 | CG34178-PB | 1..112 | 14..125 | 641 | 100 | Plus |
| CG34178-PA | 112 | CG34178-PA | 1..112 | 14..125 | 641 | 100 | Plus |
| CG2444-PB | 114 | CG2444-PB | 10..111 | 21..125 | 146 | 32.4 | Plus |
| CG2444-PA | 114 | CG2444-PA | 10..111 | 21..125 | 146 | 32.4 | Plus |
