Clone BO25950 Report

Search the DGRC for BO25950

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:259
Well:50
Vector:pDNR-Dual
Associated Gene/TranscriptNtf-2r-RA
Protein status:BO25950.pep: Imported from assembly
Sequenced Size:424

Clone Sequence Records

BO25950.complete Sequence

424 bp assembled on 2010-06-29

GenBank Submission: KX795723

> BO25950.complete
GAAGTTATCAGTCGACATGTCTCTGAATCTGCAGTACGAGGACATTGGCA
AGGAATTTGTCCAGCAGTACTACGCCATATTCGATGACCCGGCGAATCGG
GAGAACGTGATTAATTTCTATAACGCTACCGACTCTTTCATGACCTTTGA
AGGCAACCAAATACAGGGAGCACCCAAGATTCTGGAAAAAGTTCAGAGTC
TGAGCTTTCAGAAGATTGCCAGAGTGATAACCACAGTGGATTCGCAGCCA
ACTTCCGATGGCGGAGTTCTGATCATCGTCCTTGGAAGACTAAAATGCGA
TGACGATCCCCCACATGCATTCTCGCAGATCTTTTTGCTGAAGCCCAACG
GAGGATCCCTCTTCGTGGCTCACGACATCTTCCGTCTGAACATCCACAAC
TCTGCCGCAAGCTTTCTAGACCAT

BO25950.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:36:01
Subject Length Description Subject Range Query Range Score Percent Strand
Ntf-2r-RA 393 CG10174-PA 1..390 17..406 1950 100 Plus
Ntf-2-RE 393 CG1740-PE 1..390 17..406 1515 92.6 Plus
Ntf-2-RA 393 CG1740-PA 1..390 17..406 1515 92.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:36:02
Subject Length Description Subject Range Query Range Score Percent Strand
Ntf-2r-RA 771 CG10174-RA 119..508 17..406 1950 100 Plus
Ntf-2-RE 3078 CG1740-RE 146..535 17..406 1515 92.6 Plus
Ntf-2-RA 755 CG1740-RA 146..535 17..406 1515 92.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:35:59
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18454767..18455156 17..406 1950 100 Plus
X 23542271 X 21036536..21036634 194..292 435 96 Plus
X 23542271 X 21035614..21035719 17..122 410 92.5 Plus
X 23542271 X 21038746..21038856 296..406 390 90.1 Plus
X 23542271 X 21036399..21036470 125..196 315 95.8 Plus
Blast to na_te.dros performed on 2014-11-26 14:36:00 has no hits.

BO25950.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-29 17:46:12 Download gff for BO25950.complete
Subject Subject Range Query Range Percent Splice Strand
Ntf-2r-RA 46..435 17..408 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:38:20 Download gff for BO25950.complete
Subject Subject Range Query Range Percent Splice Strand
Ntf-2r-RA 119..508 17..408 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:56:23 Download gff for BO25950.complete
Subject Subject Range Query Range Percent Splice Strand
Ntf-2r-RA 119..508 17..408 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 15:56:23 Download gff for BO25950.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18454767..18455156 17..408 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:38:20 Download gff for BO25950.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18454767..18455156 17..408 99   Plus

BO25950.pep Sequence

Translation from 16 to 424

> BO25950.pep
MSLNLQYEDIGKEFVQQYYAIFDDPANRENVINFYNATDSFMTFEGNQIQ
GAPKILEKVQSLSFQKIARVITTVDSQPTSDGGVLIIVLGRLKCDDDPPH
AFSQIFLLKPNGGSLFVAHDIFRLNIHNSAASFLDH

BO25950.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:26:34
Subject Length Description Subject Range Query Range Score Percent Strand
Ntf-2r-PA 130 CG10174-PA 1..130 1..130 672 100 Plus
Ntf-2-PE 130 CG1740-PE 1..130 1..130 594 87.7 Plus
Ntf-2-PA 130 CG1740-PA 1..130 1..130 594 87.7 Plus
Ntf-2-PB 129 CG1740-PB 1..128 1..128 543 82 Plus
Ntf-2-PC 89 CG1740-PC 1..89 42..130 403 87.6 Plus