BO25950.complete Sequence
424 bp assembled on 2010-06-29
GenBank Submission: KX795723
> BO25950.complete
GAAGTTATCAGTCGACATGTCTCTGAATCTGCAGTACGAGGACATTGGCA
AGGAATTTGTCCAGCAGTACTACGCCATATTCGATGACCCGGCGAATCGG
GAGAACGTGATTAATTTCTATAACGCTACCGACTCTTTCATGACCTTTGA
AGGCAACCAAATACAGGGAGCACCCAAGATTCTGGAAAAAGTTCAGAGTC
TGAGCTTTCAGAAGATTGCCAGAGTGATAACCACAGTGGATTCGCAGCCA
ACTTCCGATGGCGGAGTTCTGATCATCGTCCTTGGAAGACTAAAATGCGA
TGACGATCCCCCACATGCATTCTCGCAGATCTTTTTGCTGAAGCCCAACG
GAGGATCCCTCTTCGTGGCTCACGACATCTTCCGTCTGAACATCCACAAC
TCTGCCGCAAGCTTTCTAGACCAT
BO25950.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:36:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Ntf-2r-RA | 393 | CG10174-PA | 1..390 | 17..406 | 1950 | 100 | Plus |
Ntf-2-RE | 393 | CG1740-PE | 1..390 | 17..406 | 1515 | 92.6 | Plus |
Ntf-2-RA | 393 | CG1740-PA | 1..390 | 17..406 | 1515 | 92.6 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:36:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Ntf-2r-RA | 771 | CG10174-RA | 119..508 | 17..406 | 1950 | 100 | Plus |
Ntf-2-RE | 3078 | CG1740-RE | 146..535 | 17..406 | 1515 | 92.6 | Plus |
Ntf-2-RA | 755 | CG1740-RA | 146..535 | 17..406 | 1515 | 92.6 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:35:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 18454767..18455156 | 17..406 | 1950 | 100 | Plus |
X | 23542271 | X | 21036536..21036634 | 194..292 | 435 | 96 | Plus |
X | 23542271 | X | 21035614..21035719 | 17..122 | 410 | 92.5 | Plus |
X | 23542271 | X | 21038746..21038856 | 296..406 | 390 | 90.1 | Plus |
X | 23542271 | X | 21036399..21036470 | 125..196 | 315 | 95.8 | Plus |
Blast to na_te.dros performed on 2014-11-26 14:36:00 has no hits.
BO25950.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-29 17:46:12 Download gff for
BO25950.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ntf-2r-RA | 46..435 | 17..408 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:38:20 Download gff for
BO25950.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ntf-2r-RA | 119..508 | 17..408 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:56:23 Download gff for
BO25950.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ntf-2r-RA | 119..508 | 17..408 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 15:56:23 Download gff for
BO25950.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 18454767..18455156 | 17..408 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:38:20 Download gff for
BO25950.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 18454767..18455156 | 17..408 | 99 | | Plus |
BO25950.pep Sequence
Translation from 16 to 424
> BO25950.pep
MSLNLQYEDIGKEFVQQYYAIFDDPANRENVINFYNATDSFMTFEGNQIQ
GAPKILEKVQSLSFQKIARVITTVDSQPTSDGGVLIIVLGRLKCDDDPPH
AFSQIFLLKPNGGSLFVAHDIFRLNIHNSAASFLDH
BO25950.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:26:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Ntf-2r-PA | 130 | CG10174-PA | 1..130 | 1..130 | 672 | 100 | Plus |
Ntf-2-PE | 130 | CG1740-PE | 1..130 | 1..130 | 594 | 87.7 | Plus |
Ntf-2-PA | 130 | CG1740-PA | 1..130 | 1..130 | 594 | 87.7 | Plus |
Ntf-2-PB | 129 | CG1740-PB | 1..128 | 1..128 | 543 | 82 | Plus |
Ntf-2-PC | 89 | CG1740-PC | 1..89 | 42..130 | 403 | 87.6 | Plus |