BO25961.complete Sequence
271 bp assembled on 2010-06-29
GenBank Submission: KX797243
> BO25961.complete
GAAGTTATCAGTCGACATGTCCCTGGTTTCAGATGAGGAGTGGGTGGAGT
ACAAGTCCAAGTTCGACAAGAACTACGAGGCAGAGGAGGATCTGATGCGT
CGTAGAATCTACGCCGAGTCCAAAGCCCGGATTGAGGAACACAATCGGAA
GTTCGAGAAGGGCGAAGTGACTTGGAAAATGGGAATTAATCATTTGGCTG
ATCTCACGCCTGAGGAATTTGCCCAGCGTTGTGGCAAAAAGGTGCCGCCA
AATGCAAGCTTTCTAGACCAT
BO25961.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:35:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
cer-RA | 240 | CG10460-PA | 1..237 | 17..253 | 1185 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:35:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
cer-RA | 497 | CG10460-RA | 111..347 | 17..253 | 1185 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:35:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 19396365..19396564 | 253..54 | 1000 | 100 | Minus |
2R | 25286936 | 2R | 19396624..19396662 | 55..17 | 195 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-26 14:35:32 has no hits.
BO25961.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-29 17:46:09 Download gff for
BO25961.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cer-RA | 99..335 | 17..255 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:38:09 Download gff for
BO25961.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cer-RA | 111..347 | 17..255 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:56:16 Download gff for
BO25961.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cer-RA | 111..347 | 17..255 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 15:56:16 Download gff for
BO25961.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 19396363..19396562 | 56..255 | 99 | <- | Minus |
2R | 19396624..19396662 | 17..55 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:38:09 Download gff for
BO25961.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 15283868..15284067 | 56..255 | 99 | <- | Minus |
arm_2R | 15284129..15284167 | 17..55 | 100 | | Minus |
BO25961.pep Sequence
Translation from 16 to 271
> BO25961.pep
MSLVSDEEWVEYKSKFDKNYEAEEDLMRRRIYAESKARIEEHNRKFEKGE
VTWKMGINHLADLTPEEFAQRCGKKVPPNASFLDH
BO25961.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:26:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
cer-PA | 79 | CG10460-PA | 1..79 | 1..79 | 423 | 100 | Plus |
Cp1-PA | 341 | CG6692-PA | 27..91 | 7..70 | 138 | 41.5 | Plus |
Cp1-PC | 371 | CG6692-PC | 57..121 | 7..70 | 138 | 41.5 | Plus |