Clone BO25961 Report

Search the DGRC for BO25961

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:259
Well:61
Vector:pDNR-Dual
Associated Gene/Transcriptcer-RA
Protein status:BO25961.pep: Imported from assembly
Sequenced Size:271

Clone Sequence Records

BO25961.complete Sequence

271 bp assembled on 2010-06-29

GenBank Submission: KX797243

> BO25961.complete
GAAGTTATCAGTCGACATGTCCCTGGTTTCAGATGAGGAGTGGGTGGAGT
ACAAGTCCAAGTTCGACAAGAACTACGAGGCAGAGGAGGATCTGATGCGT
CGTAGAATCTACGCCGAGTCCAAAGCCCGGATTGAGGAACACAATCGGAA
GTTCGAGAAGGGCGAAGTGACTTGGAAAATGGGAATTAATCATTTGGCTG
ATCTCACGCCTGAGGAATTTGCCCAGCGTTGTGGCAAAAAGGTGCCGCCA
AATGCAAGCTTTCTAGACCAT

BO25961.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:35:33
Subject Length Description Subject Range Query Range Score Percent Strand
cer-RA 240 CG10460-PA 1..237 17..253 1185 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:35:35
Subject Length Description Subject Range Query Range Score Percent Strand
cer-RA 497 CG10460-RA 111..347 17..253 1185 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:35:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19396365..19396564 253..54 1000 100 Minus
2R 25286936 2R 19396624..19396662 55..17 195 100 Minus
Blast to na_te.dros performed on 2014-11-26 14:35:32 has no hits.

BO25961.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-29 17:46:09 Download gff for BO25961.complete
Subject Subject Range Query Range Percent Splice Strand
cer-RA 99..335 17..255 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:38:09 Download gff for BO25961.complete
Subject Subject Range Query Range Percent Splice Strand
cer-RA 111..347 17..255 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:56:16 Download gff for BO25961.complete
Subject Subject Range Query Range Percent Splice Strand
cer-RA 111..347 17..255 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 15:56:16 Download gff for BO25961.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19396363..19396562 56..255 99 <- Minus
2R 19396624..19396662 17..55 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:38:09 Download gff for BO25961.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15283868..15284067 56..255 99 <- Minus
arm_2R 15284129..15284167 17..55 100   Minus

BO25961.pep Sequence

Translation from 16 to 271

> BO25961.pep
MSLVSDEEWVEYKSKFDKNYEAEEDLMRRRIYAESKARIEEHNRKFEKGE
VTWKMGINHLADLTPEEFAQRCGKKVPPNASFLDH

BO25961.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:26:12
Subject Length Description Subject Range Query Range Score Percent Strand
cer-PA 79 CG10460-PA 1..79 1..79 423 100 Plus
Cp1-PA 341 CG6692-PA 27..91 7..70 138 41.5 Plus
Cp1-PC 371 CG6692-PC 57..121 7..70 138 41.5 Plus