Clone BO26126 Report

Search the DGRC for BO26126

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:261
Well:26
Vector:pDNR-Dual
Associated Gene/TranscriptCG32039-RA
Protein status:BO26126.pep: Imported from assembly
Sequenced Size:280

Clone Sequence Records

BO26126.complete Sequence

280 bp assembled on 2010-06-29

GenBank Submission: KX800143

> BO26126.complete
GAAGTTATCAGTCGACATGGGAGCCTGTCTGTCCTGCTGCGGCCAAAGCG
CCGAGGAAACCAACCTGATGCCATCGCCTGAGGAGCGCCGCCAGCAGCAG
TTGGATGCGGCGGAAAAGCGTCGCCAGGAGAATGAACATCGGGGCATTAA
GAATCCGGACAGCGTACGCCGACAGCAACAAAGAGCGGAGGAAATGCAAC
GCAGGGAGGAGGAGGCCGCCCGTCAGGGTCAAGGACAATCCAATCTTAGG
TGGCAAACTAGCGCAAGCTTTCTAGACCAT

BO26126.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:31:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG32039-RB 249 CG32039-PB 1..246 17..262 1230 100 Plus
CG32039-RA 249 CG32039-PA 1..246 17..262 1230 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:31:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG32039-RB 881 CG32039-RB 126..372 16..262 1235 100 Plus
CG32039-RA 632 CG32039-RA 126..372 16..262 1235 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:31:08
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9359246..9359416 80..250 855 100 Plus
3L 28110227 3L 9359124..9359188 16..80 325 100 Plus
Blast to na_te.dros performed on 2014-11-26 14:31:09 has no hits.

BO26126.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-29 17:45:26 Download gff for BO26126.complete
Subject Subject Range Query Range Percent Splice Strand
CG32039-RA 103..348 17..264 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:36:18 Download gff for BO26126.complete
Subject Subject Range Query Range Percent Splice Strand
CG32039-RA 127..372 17..264 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:54:37 Download gff for BO26126.complete
Subject Subject Range Query Range Percent Splice Strand
CG32039-RA 127..372 17..264 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 15:54:37 Download gff for BO26126.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9359125..9359187 17..79 100 -> Plus
3L 9359246..9359416 80..250 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:36:18 Download gff for BO26126.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9352225..9352287 17..79 100 -> Plus
arm_3L 9352346..9352516 80..250 100 -> Plus

BO26126.pep Sequence

Translation from 16 to 280

> BO26126.pep
MGACLSCCGQSAEETNLMPSPEERRQQQLDAAEKRRQENEHRGIKNPDSV
RRQQQRAEEMQRREEEAARQGQGQSNLRWQTSASFLDH

BO26126.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:34:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG32039-PB 82 CG32039-PB 1..82 1..82 429 100 Plus
CG32039-PA 82 CG32039-PA 1..82 1..82 429 100 Plus