BO26130.complete Sequence
415 bp assembled on 2010-06-29
GenBank Submission: KX799128
> BO26130.complete
GAAGTTATCAGTCGACATGCCGTACATAATCATACGGGGGAATCTAGCCT
CCTACAGCCACAAATATCCATGGAGGGTGCTCGTCTCCGGGTTGAAAGCT
GACGACATCGAGCAGTTGAACAAGTTCTCCTGCGGCGGCTACAGCGACGA
GTCCACCATCGTCTACTTAGTGCATCCTTGTCGGATTTTATCGGCGCTAG
AAATCCTGGGATTTCGCGTAGTGGCCAGCTCATCGACTGCCGTGAAGCAG
GACTACAACGAGTACATGTGGACGATGCGCAAGGAGTTCGACGAACCAGA
ACCCTTGGAAGCCGAGTCCGTGGTGCGAGAAAATCTATCGAATATTGGCC
GCGAGGCAGCCAGTTTAGGCAACTATCACAAGGTGGATTCGCCTGAAGCA
AGCTTTCTAGACCAT
BO26130.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:31:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33995-RC | 384 | CG33995-PC | 1..381 | 17..397 | 1905 | 100 | Plus |
CG33995-RB | 384 | CG33995-PB | 1..381 | 17..397 | 1905 | 100 | Plus |
CG33995-RA | 384 | CG33995-PA | 1..381 | 17..397 | 1905 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:31:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG44001-RE | 2431 | CG44001-RE | 156..536 | 17..397 | 1905 | 100 | Plus |
CG44001-RD | 2415 | CG44001-RD | 140..520 | 17..397 | 1905 | 100 | Plus |
CG44001-RA | 2691 | CG44001-RA | 416..796 | 17..397 | 1905 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:31:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 5046147..5046341 | 203..397 | 975 | 100 | Plus |
2L | 23513712 | 2L | 5045820..5045925 | 97..202 | 530 | 100 | Plus |
2L | 23513712 | 2L | 5044608..5044689 | 17..98 | 410 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 14:31:04 has no hits.
BO26130.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-29 17:45:25 Download gff for
BO26130.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31919-RC | 417..797 | 17..399 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:36:17 Download gff for
BO26130.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG44001-RA | 416..796 | 17..399 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:54:35 Download gff for
BO26130.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG44001-RA | 416..796 | 17..399 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 15:54:35 Download gff for
BO26130.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 5044608..5044689 | 17..98 | 100 | -> | Plus |
2L | 5045822..5045925 | 99..202 | 100 | -> | Plus |
2L | 5046147..5046341 | 203..399 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:36:17 Download gff for
BO26130.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 5044608..5044689 | 17..98 | 100 | -> | Plus |
arm_2L | 5045822..5045925 | 99..202 | 100 | -> | Plus |
arm_2L | 5046147..5046341 | 203..399 | 98 | | Plus |
BO26130.pep Sequence
Translation from 16 to 415
> BO26130.pep
MPYIIIRGNLASYSHKYPWRVLVSGLKADDIEQLNKFSCGGYSDESTIVY
LVHPCRILSALEILGFRVVASSSTAVKQDYNEYMWTMRKEFDEPEPLEAE
SVVRENLSNIGREAASLGNYHKVDSPEASFLDH
BO26130.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:34:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33995-PC | 127 | CG33995-PC | 1..127 | 1..127 | 663 | 100 | Plus |
CG33995-PB | 127 | CG33995-PB | 1..127 | 1..127 | 663 | 100 | Plus |
CG33995-PA | 127 | CG33995-PA | 1..127 | 1..127 | 663 | 100 | Plus |