Clone BO26130 Report

Search the DGRC for BO26130

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:261
Well:30
Vector:pDNR-Dual
Associated Gene/TranscriptCG31919-RG
Protein status:BO26130.pep: Imported from assembly
Sequenced Size:415

Clone Sequence Records

BO26130.complete Sequence

415 bp assembled on 2010-06-29

GenBank Submission: KX799128

> BO26130.complete
GAAGTTATCAGTCGACATGCCGTACATAATCATACGGGGGAATCTAGCCT
CCTACAGCCACAAATATCCATGGAGGGTGCTCGTCTCCGGGTTGAAAGCT
GACGACATCGAGCAGTTGAACAAGTTCTCCTGCGGCGGCTACAGCGACGA
GTCCACCATCGTCTACTTAGTGCATCCTTGTCGGATTTTATCGGCGCTAG
AAATCCTGGGATTTCGCGTAGTGGCCAGCTCATCGACTGCCGTGAAGCAG
GACTACAACGAGTACATGTGGACGATGCGCAAGGAGTTCGACGAACCAGA
ACCCTTGGAAGCCGAGTCCGTGGTGCGAGAAAATCTATCGAATATTGGCC
GCGAGGCAGCCAGTTTAGGCAACTATCACAAGGTGGATTCGCCTGAAGCA
AGCTTTCTAGACCAT

BO26130.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:31:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG33995-RC 384 CG33995-PC 1..381 17..397 1905 100 Plus
CG33995-RB 384 CG33995-PB 1..381 17..397 1905 100 Plus
CG33995-RA 384 CG33995-PA 1..381 17..397 1905 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:31:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG44001-RE 2431 CG44001-RE 156..536 17..397 1905 100 Plus
CG44001-RD 2415 CG44001-RD 140..520 17..397 1905 100 Plus
CG44001-RA 2691 CG44001-RA 416..796 17..397 1905 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:31:03
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5046147..5046341 203..397 975 100 Plus
2L 23513712 2L 5045820..5045925 97..202 530 100 Plus
2L 23513712 2L 5044608..5044689 17..98 410 100 Plus
Blast to na_te.dros performed on 2014-11-26 14:31:04 has no hits.

BO26130.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-29 17:45:25 Download gff for BO26130.complete
Subject Subject Range Query Range Percent Splice Strand
CG31919-RC 417..797 17..399 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:36:17 Download gff for BO26130.complete
Subject Subject Range Query Range Percent Splice Strand
CG44001-RA 416..796 17..399 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:54:35 Download gff for BO26130.complete
Subject Subject Range Query Range Percent Splice Strand
CG44001-RA 416..796 17..399 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 15:54:35 Download gff for BO26130.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5044608..5044689 17..98 100 -> Plus
2L 5045822..5045925 99..202 100 -> Plus
2L 5046147..5046341 203..399 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:36:17 Download gff for BO26130.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5044608..5044689 17..98 100 -> Plus
arm_2L 5045822..5045925 99..202 100 -> Plus
arm_2L 5046147..5046341 203..399 98   Plus

BO26130.pep Sequence

Translation from 16 to 415

> BO26130.pep
MPYIIIRGNLASYSHKYPWRVLVSGLKADDIEQLNKFSCGGYSDESTIVY
LVHPCRILSALEILGFRVVASSSTAVKQDYNEYMWTMRKEFDEPEPLEAE
SVVRENLSNIGREAASLGNYHKVDSPEASFLDH

BO26130.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:34:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG33995-PC 127 CG33995-PC 1..127 1..127 663 100 Plus
CG33995-PB 127 CG33995-PB 1..127 1..127 663 100 Plus
CG33995-PA 127 CG33995-PA 1..127 1..127 663 100 Plus