BO26132.complete Sequence
187 bp assembled on 2010-06-29
GenBank Submission: KX800072
> BO26132.complete
GAAGTTATCAGTCGACATGAACGTATTCAATGGTTTCTTGCTAGTCTTCC
TGGGCCTGGCCCTCAGCTCTGTGGATGCACAGATAGCAACACGCCAGGAA
ACCTCGGAGGACAAGGCTTGTGGTCCCCACGCCTACTACAATTACGCCCG
GCACACTTGCCTGCCATTCGCAAGCTTTCTAGACCAT
BO26132.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:56:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Met75Ca-RA | 156 | CG32197-PA | 1..153 | 17..169 | 765 | 100 | Plus |
Met75Cb-RA | 156 | CG18064-PA | 1..153 | 17..169 | 765 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:56:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Met75Ca-RA | 242 | CG32197-RA | 21..173 | 17..169 | 765 | 100 | Plus |
Met75Cb-RA | 241 | CG18064-RA | 21..173 | 17..169 | 765 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:56:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 18469446..18469598 | 169..17 | 765 | 100 | Minus |
3L | 28110227 | 3L | 18472212..18472364 | 169..17 | 765 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-27 00:56:36 has no hits.
BO26132.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-09 16:56:56 Download gff for
BO26132.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Met75Cb-RA | 2..154 | 17..171 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:39:24 Download gff for
BO26132.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Met75Ca-RA | 21..173 | 17..171 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:14:17 Download gff for
BO26132.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Met75Cb-RA | 21..173 | 17..171 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:14:17 Download gff for
BO26132.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 18469444..18469598 | 17..171 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:39:24 Download gff for
BO26132.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 18462544..18462698 | 17..171 | 98 | | Minus |
BO26132.pep Sequence
Translation from 16 to 187
> BO26132.pep
MNVFNGFLLVFLGLALSSVDAQIATRQETSEDKACGPHAYYNYARHTCLP
FASFLDH
BO26132.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:26:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Met75Ca-PA | 51 | CG32197-PA | 1..51 | 1..51 | 272 | 100 | Plus |
Met75Cb-PA | 51 | CG18064-PA | 1..51 | 1..51 | 272 | 100 | Plus |