Clone BO26132 Report

Search the DGRC for BO26132

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:261
Well:32
Vector:pDNR-Dual
Associated Gene/TranscriptMet75Ca-RA
Protein status:BO26132.pep: Inserted from web
Sequenced Size:187

Clone Sequence Records

BO26132.complete Sequence

187 bp assembled on 2010-06-29

GenBank Submission: KX800072

> BO26132.complete
GAAGTTATCAGTCGACATGAACGTATTCAATGGTTTCTTGCTAGTCTTCC
TGGGCCTGGCCCTCAGCTCTGTGGATGCACAGATAGCAACACGCCAGGAA
ACCTCGGAGGACAAGGCTTGTGGTCCCCACGCCTACTACAATTACGCCCG
GCACACTTGCCTGCCATTCGCAAGCTTTCTAGACCAT

BO26132.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:56:36
Subject Length Description Subject Range Query Range Score Percent Strand
Met75Ca-RA 156 CG32197-PA 1..153 17..169 765 100 Plus
Met75Cb-RA 156 CG18064-PA 1..153 17..169 765 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:56:37
Subject Length Description Subject Range Query Range Score Percent Strand
Met75Ca-RA 242 CG32197-RA 21..173 17..169 765 100 Plus
Met75Cb-RA 241 CG18064-RA 21..173 17..169 765 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:56:35
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18469446..18469598 169..17 765 100 Minus
3L 28110227 3L 18472212..18472364 169..17 765 100 Minus
Blast to na_te.dros performed on 2014-11-27 00:56:36 has no hits.

BO26132.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-09 16:56:56 Download gff for BO26132.complete
Subject Subject Range Query Range Percent Splice Strand
Met75Cb-RA 2..154 17..171 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:39:24 Download gff for BO26132.complete
Subject Subject Range Query Range Percent Splice Strand
Met75Ca-RA 21..173 17..171 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:14:17 Download gff for BO26132.complete
Subject Subject Range Query Range Percent Splice Strand
Met75Cb-RA 21..173 17..171 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:14:17 Download gff for BO26132.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18469444..18469598 17..171 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:39:24 Download gff for BO26132.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18462544..18462698 17..171 98   Minus

BO26132.pep Sequence

Translation from 16 to 187

> BO26132.pep
MNVFNGFLLVFLGLALSSVDAQIATRQETSEDKACGPHAYYNYARHTCLP
FASFLDH

BO26132.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:26:00
Subject Length Description Subject Range Query Range Score Percent Strand
Met75Ca-PA 51 CG32197-PA 1..51 1..51 272 100 Plus
Met75Cb-PA 51 CG18064-PA 1..51 1..51 272 100 Plus