BO26138.complete Sequence
319 bp assembled on 2010-06-29
GenBank Submission: KX795833
> BO26138.complete
GAAGTTATCAGTCGACATGCACAAAATAGCAGCAGCGCCGCCTCCATCGG
CAACGCCCGGCGGAGGACTGGAGACGCCCCTGGCGGCGCCAAAATACGGC
ACACTAATACCCAATCGCATCTTTGTGGGTGGCATCAGCGGCGATACCAC
CGAGGCTGATCTAACCCGCGTCTTCAGCGCCTATGGCACGGTAAAGAGCA
CCAAAATCATCGTGGATCGAGCAGGTGTGAGCAAGGGCTACGGATTCGTC
ACCTTCGAGACGGAGCAGGAGGCGCAAAGACTGCAAGCGGATGGCATTAC
CGCAAGCTTTCTAGACCAT
BO26138.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:30:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
bol-RE | 288 | CG4760-PE | 1..285 | 17..301 | 1425 | 100 | Plus |
bol-RF | 702 | CG4760-PF | 1..278 | 17..294 | 1390 | 100 | Plus |
bol-RG | 687 | CG4760-PG | 1..278 | 17..294 | 1390 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:30:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
bol-RE | 2023 | CG4760-RE | 629..913 | 17..301 | 1425 | 100 | Plus |
bol-RF | 6538 | CG4760-RF | 780..1057 | 17..294 | 1390 | 100 | Plus |
bol-RG | 2930 | CG4760-RG | 1199..1476 | 17..294 | 1390 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:30:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 9112633..9112789 | 293..137 | 785 | 100 | Minus |
3L | 28110227 | 3L | 9113046..9113167 | 138..17 | 610 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-26 14:30:46 has no hits.
BO26138.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-29 17:45:21 Download gff for
BO26138.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
bol-RE | 595..879 | 17..303 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:36:09 Download gff for
BO26138.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
bol-RE | 629..913 | 17..303 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:54:27 Download gff for
BO26138.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
bol-RE | 629..913 | 17..303 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 15:54:27 Download gff for
BO26138.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 9112627..9112787 | 139..299 | 98 | <- | Minus |
3L | 9113046..9113167 | 17..138 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:36:09 Download gff for
BO26138.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 9105727..9105887 | 139..299 | 98 | <- | Minus |
arm_3L | 9106146..9106267 | 17..138 | 100 | | Minus |
BO26138.pep Sequence
Translation from 16 to 319
> BO26138.pep
MHKIAAAPPPSATPGGGLETPLAAPKYGTLIPNRIFVGGISGDTTEADLT
RVFSAYGTVKSTKIIVDRAGVSKGYGFVTFETEQEAQRLQADGITASFLD
H
BO26138.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:35:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
bol-PE | 95 | CG4760-PE | 1..95 | 1..95 | 485 | 100 | Plus |
bol-PA | 189 | CG4760-PA | 1..93 | 1..93 | 476 | 100 | Plus |
bol-PC | 189 | CG4760-PC | 1..93 | 1..93 | 476 | 100 | Plus |
bol-PG | 228 | CG4760-PG | 1..93 | 1..93 | 476 | 100 | Plus |
bol-PD | 228 | CG4760-PD | 1..93 | 1..93 | 476 | 100 | Plus |