BO26144.complete Sequence
178 bp assembled on 2010-06-29
GenBank Submission: KX794977
> BO26144.complete
GAAGTTATCAGTCGACATGAAGACACCGGACACCAAAGCCAAGTTGCTGA
ATAATATAAGTCTATCTAAACACCTGTCTTCCAAGAAAGGCGGCTCTCGC
ACTAGTAACTGCGGCAATTGTCTGGAATTCTCCGTACTCACGCGTCTCTC
CAGCGTGCCCGCAAGCTTTCTAGACCAT
BO26144.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:30:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42305-RC | 147 | CG42305-PC | 1..144 | 17..160 | 720 | 100 | Plus |
CG42305-RB | 147 | CG42305-PB | 1..144 | 17..160 | 720 | 100 | Plus |
CG42305-RA | 147 | CG42305-PA | 1..144 | 17..160 | 720 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:30:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42305-RC | 1018 | CG42305-RC | 453..596 | 17..160 | 720 | 100 | Plus |
CG42305-RB | 779 | CG42305-RB | 92..235 | 17..160 | 720 | 100 | Plus |
CG42305-RA | 657 | CG42305-RA | 92..235 | 17..160 | 720 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:30:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 18813296..18813397 | 59..160 | 510 | 100 | Plus |
2L | 23513712 | 2L | 18813100..18813143 | 17..60 | 220 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 14:30:29 has no hits.
BO26144.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-29 17:45:18 Download gff for
BO26144.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17325-RA | 91..234 | 17..162 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:36:01 Download gff for
BO26144.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42305-RB | 92..235 | 17..162 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:54:19 Download gff for
BO26144.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42305-RA | 92..235 | 17..162 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 15:54:19 Download gff for
BO26144.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 18813100..18813143 | 17..60 | 100 | -> | Plus |
2L | 18813298..18813397 | 61..162 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:36:01 Download gff for
BO26144.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 18813100..18813143 | 17..60 | 100 | -> | Plus |
arm_2L | 18813298..18813397 | 61..162 | 98 | | Plus |
BO26144.pep Sequence
Translation from 16 to 178
> BO26144.pep
MKTPDTKAKLLNNISLSKHLSSKKGGSRTSNCGNCLEFSVLTRLSSVPAS
FLDH
BO26144.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:36:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42305-PC | 48 | CG42305-PC | 1..48 | 1..48 | 244 | 100 | Plus |
CG42305-PB | 48 | CG42305-PB | 1..48 | 1..48 | 244 | 100 | Plus |
CG42305-PA | 48 | CG42305-PA | 1..48 | 1..48 | 244 | 100 | Plus |