Clone BO26144 Report

Search the DGRC for BO26144

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:261
Well:44
Vector:pDNR-Dual
Associated Gene/TranscriptCG42305-RA
Protein status:BO26144.pep: Imported from assembly
Sequenced Size:178

Clone Sequence Records

BO26144.complete Sequence

178 bp assembled on 2010-06-29

GenBank Submission: KX794977

> BO26144.complete
GAAGTTATCAGTCGACATGAAGACACCGGACACCAAAGCCAAGTTGCTGA
ATAATATAAGTCTATCTAAACACCTGTCTTCCAAGAAAGGCGGCTCTCGC
ACTAGTAACTGCGGCAATTGTCTGGAATTCTCCGTACTCACGCGTCTCTC
CAGCGTGCCCGCAAGCTTTCTAGACCAT

BO26144.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:30:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG42305-RC 147 CG42305-PC 1..144 17..160 720 100 Plus
CG42305-RB 147 CG42305-PB 1..144 17..160 720 100 Plus
CG42305-RA 147 CG42305-PA 1..144 17..160 720 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:30:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG42305-RC 1018 CG42305-RC 453..596 17..160 720 100 Plus
CG42305-RB 779 CG42305-RB 92..235 17..160 720 100 Plus
CG42305-RA 657 CG42305-RA 92..235 17..160 720 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:30:28
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18813296..18813397 59..160 510 100 Plus
2L 23513712 2L 18813100..18813143 17..60 220 100 Plus
Blast to na_te.dros performed on 2014-11-26 14:30:29 has no hits.

BO26144.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-29 17:45:18 Download gff for BO26144.complete
Subject Subject Range Query Range Percent Splice Strand
CG17325-RA 91..234 17..162 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:36:01 Download gff for BO26144.complete
Subject Subject Range Query Range Percent Splice Strand
CG42305-RB 92..235 17..162 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:54:19 Download gff for BO26144.complete
Subject Subject Range Query Range Percent Splice Strand
CG42305-RA 92..235 17..162 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 15:54:19 Download gff for BO26144.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18813100..18813143 17..60 100 -> Plus
2L 18813298..18813397 61..162 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:36:01 Download gff for BO26144.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18813100..18813143 17..60 100 -> Plus
arm_2L 18813298..18813397 61..162 98   Plus

BO26144.pep Sequence

Translation from 16 to 178

> BO26144.pep
MKTPDTKAKLLNNISLSKHLSSKKGGSRTSNCGNCLEFSVLTRLSSVPAS
FLDH

BO26144.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:36:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG42305-PC 48 CG42305-PC 1..48 1..48 244 100 Plus
CG42305-PB 48 CG42305-PB 1..48 1..48 244 100 Plus
CG42305-PA 48 CG42305-PA 1..48 1..48 244 100 Plus